SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014802 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014802
Domain Number 1 Region: 131-193
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.88e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 80-142
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 3 Region: 22-87
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000103
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014802   Gene: ENSTTRG00000015630   Transcript: ENSTTRT00000015624
Sequence length 256
Comment pep:known_by_projection scaffold:turTru1:scaffold_108815:54440:64573:1 gene:ENSTTRG00000015630 transcript:ENSTTRT00000015624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFWFMCCLVDMWLISASDAEICPELPPVDNSIFVAKEGEGQILGTYLCNNGYHLVGEKT
LFCNASKGWNASAPECCLGHCPDPLLVNGEFSSLEPVNVNDTVTFKCNEHYVLKGSNWSR
CLENHTWVPPFPVCKSRDCGPPENPTHGYFEGTDFNSGSTITYYCEARYYLVGTQQQQCI
DGEWSSTLPVCELIREAPKPAELELEKALLAFQESKELCKAIVNFTQRLKKSGLTMEKEK
FFLEIRKAELKTKMLP
Download sequence
Identical sequences ENSTTRP00000014802 ENSTTRP00000014802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]