SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014886 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014886
Domain Number 1 Region: 38-367,399-535
Classification Level Classification E-value
Superfamily Clc chloride channel 1.7e-88
Family Clc chloride channel 0.0013
Further Details:      
 
Domain Number 2 Region: 540-608
Classification Level Classification E-value
Superfamily CBS-domain pair 0.000000000367
Family CBS-domain pair 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014886   Gene: ENSTTRG00000015710   Transcript: ENSTTRT00000015710
Sequence length 687
Comment pep:novel genescaffold:turTru1:GeneScaffold_198:176176:187863:1 gene:ENSTTRG00000015710 transcript:ENSTTRT00000015710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELVGLREGSSGNPVTLQELWGPCPRIRRGIRGGLEWLKQKLFRMGEDWYFLMTLGVLM
ALISYTMSFTVGRVVRAHKWLYREIGDSHLLRYLSWTVYPVALVSFSSGFSQSITPFSGG
SGIPELKTILSGVVLEDYLDIKNFGAKVVGLTCTLATGSTIFLGKVGPFVHLSVMIAAYL
GRLRTKAIGESENKSKQNEMLVAAAAVGVATVFAAPFSGVLFSIEVMSSHFSVWDYWRGF
FAATCGAFMFRLLAVFNSEQETITSLYKTSFRVDVPFDLPEIFFFVALGAICGILSCAYL
FCQRTFLGFVKTNRVLSKLLATSKPLYSALAALVLASITYPPGVGRFMASRLSMREHLDS
LFDNNSWALMTRNSSPPWPSEPDPQNLWFEWYHPQFTIFGTLAFFLVMKFWMIILATTIP
MPAGYFMPIFIFGAAIGRLIGEALSVAFPEGIVAGGVTNPIMPGGYALAGAAAFSGAVTH
TISTALLAFELTGQIVHALPVLMAVLAANAIAQSCQPSFYDGTIIVKRLPYLPWIRCRKI
SSHHVIVEHFMNCTITTLAKDTPQEEVVKVVTSTDTAEYPLVESTESQILVGTVRRAHLV
QALQAEPPSWVPGHQQCLQDILAGGCPVEPVTLKLSPETSLHQXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXLKKAISNLTNPPAPK
Download sequence
Identical sequences ENSTTRP00000014886 ENSTTRP00000014886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]