SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014927 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014927
Domain Number 1 Region: 192-394
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.93e-52
Family DBL homology domain (DH-domain) 0.00000173
Further Details:      
 
Domain Number 2 Region: 381-540
Classification Level Classification E-value
Superfamily PH domain-like 7.34e-32
Family Pleckstrin-homology domain (PH domain) 0.0061
Further Details:      
 
Domain Number 3 Region: 623-761
Classification Level Classification E-value
Superfamily SH2 domain 9.15e-24
Family SH2 domain 0.00083
Further Details:      
 
Domain Number 4 Region: 2-216
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.55e-21
Family Calponin-homology domain, CH-domain 0.0049
Further Details:      
 
Domain Number 5 Region: 580-657
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000354
Family SH3-domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000014927
Domain Number - Region: 858-869
Classification Level Classification E-value
Superfamily SH3-domain 0.0748
Family SH3-domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014927   Gene: ENSTTRG00000015740   Transcript: ENSTTRT00000015752
Sequence length 872
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2200:8676:175807:-1 gene:ENSTTRG00000015740 transcript:ENSTTRT00000015752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDV
NFRPQMSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVISAVSRLSLHNL
AQTKGIRPFPSEETAENDDDVYRSLEELADEHDVGEDIYDCVPCEDEGDDIYEDIIKVEV
QQPMVSPKMGMTEDDKRSCCLLEIQETEAKYYRTLEDIEKNYVTPLRLVLSPADMAAIFI
NLEDLIKVHHSFLRAIDVSMMAGGSSLAKVFLDFKERLLIYGEYCSRMEHAQTTLSQLLA
GREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSTDRPERQQLKEA
LEAMQDLAMYINEVKRDKETLKKIGEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNHTK
QDRYLFLFDKAVIVCKRRGDSYELKEIIELLFHKMTDDPMNNKDVKKSHAWSYGFYLIHL
QGKQGFQFFCKTEDMKRKWTEQFEMAMSNIKPDKATANQHSFQMYTFDKTTNCRACRMFL
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGGRDTSGVGPGPKMVAVQNYHGNPAPPG
KPVLTFQTGDVIELLRGDPESQWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISRPPSRD
MDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERAISIKFNDEVKHIKVVEKD
SWVHITEAKKFESLSELVEYYQCHSLKESFKQLDTTLKYPYKSRERVASRASSRSPASCA
SYNFSFLSPQGFSLASQGSSVPFWPVFTPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXIGWFPSTYVEEEGIQ
Download sequence
Identical sequences ENSTTRP00000014927 ENSTTRP00000014927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]