SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014940 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014940
Domain Number 1 Region: 108-198
Classification Level Classification E-value
Superfamily Caspase-like 3.89e-26
Family Caspase catalytic domain 0.0000078
Further Details:      
 
Domain Number 2 Region: 244-342
Classification Level Classification E-value
Superfamily Caspase-like 1.03e-23
Family Caspase catalytic domain 0.00000475
Further Details:      
 
Domain Number 3 Region: 4-54
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000155
Family Caspase recruitment domain, CARD 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014940   Gene: ENSTTRG00000015767   Transcript: ENSTTRT00000015765
Sequence length 365
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1664:230342:253278:-1 gene:ENSTTRG00000015767 transcript:ENSTTRT00000015765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAGSGSRRDQARQLITDLETRGSQALPLFISCLEDTGQETLASFLRTSRQAAKPSRPSQG
KLAPVVLGPEELWPAKLSPEVLRPEAPRPVDIGSGGFSEIRAQDRAKGNADLAYVLNADP
CGHCLIINNVNFCHESGLRTRTGSSIDCERMQQRFHLLHFVVEVKCNLTAKELARRDHSA
LDCCVVVILSHGCQASHLQPGAVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXQKDQGFEVASTSPEDRTPDSDPEPDATPFQEGPVTVDQPDAVSSLPTPSDILVSYST
FPGFVSWRDTKSGSWYIETLDSIFEQWAHCEDLQTLLLRVRLVRASVSSPGQVVGLSRAP
SPSQR
Download sequence
Identical sequences ENSTTRP00000014940 ENSTTRP00000014940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]