SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014964 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014964
Domain Number 1 Region: 1014-1114
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-29
Family Ras-binding domain, RBD 0.00095
Further Details:      
 
Domain Number 2 Region: 14-98
Classification Level Classification E-value
Superfamily PDZ domain-like 4.13e-19
Family PDZ domain 0.01
Further Details:      
 
Domain Number 3 Region: 702-834
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.05e-18
Family Regulator of G-protein signaling, RGS 0.001
Further Details:      
 
Domain Number 4 Region: 959-1028
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000129
Family Ras-binding domain, RBD 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014964   Gene: ENSTTRG00000015789   Transcript: ENSTTRT00000015790
Sequence length 1405
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2182:35662:127409:1 gene:ENSTTRG00000015789 transcript:ENSTTRT00000015790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRAGDLGERPLLGTAPPRTRSVEVARGRAGYGFALSGQAPCVLSCVMRGSPADFVGLRA
GDQILAVNEINVKTASHEDVVKLIGKCSGVLHMVIGEGIGHLESCSSDEEVGFYEGKGWL
KPKLDSKALGINRAERVVEEMQSGGILNMIFENPGLRASSSEPLKLKQRSLSESATGRFD
LGHEGVNNPNTSLLAKEEIPRAVNDDSVFSVGLETHEDFGVDASILNVAMVVGYLGSIEL
RHSCSLQSDSVAIRGCLRRLRAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFSHKIHQGIAWRFGFE
CTADPDTNGCLEFPASSLPVLQFISVLYRDMGELIEGVRARAFADGDADAHQNTSTSSNS
DSGIGNFTHEDRSSRVLVLDLGASSSRHGPSGSAWEGVVGRGSQPWGGPWNGAFGHDPEG
APFEAALQADRCRDLGKHLGPTPHVEAPPASLRCSVPPSKRGAAGPGGGFGQRWLPVHVL
QEWQCGHTSDQESYTDSTDGWSSINCGTLPPPMSKIPADRYRLEGSPAQPAPSTQKRDWA
RKALGMQNIFGPHRNVRKTKEDKKGSKFGRGIGLLPPAQRTSARRSFGRSRRLSITRSLD
DLESATVSDGELNGADLKDCVSNHSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDP
LGVRYFSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSYRAREIFSKFLSSKATTPVN
IDSQAQLADDILSAPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILTEVEGRPLPD
AQQVPSSPTSKHSVGSDHSNTSTPKKLNGKSKSGRSLNEELGDEDSEKKRKGAFFSWSRT
RSAGRSQKKKDQGDRPSDPAHANGGLGRRESQGSMTSAGSLDLPEACRTLAPEKDKAAKH
CSIQLPDGTACVVLVRAGLSIKEVLAGLCERHGINGAAVDLFLVGGDKPLVLHQDSSILE
SRDLRLEKRTLFRLDLVPINRSVGLKAKPSKPVAEVLRPVAAKYGLRLSELVARLSGEKE
PLDLGAPISSLDGQRVILEEKDPSRGKAPTDKQKSGPAKQSAAVNASSRNHSAMGEERTL
GKSNSIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEDFFELISQAQSNRAD
DQRGLLRKEDLVLPELRLPPGPPGLALSPSAAPKAFCTRPATGHSEEGAPRPRESPATSP
GSADSPPSSPGTPGTPSPPAQAAEAGGVQTVEGEHVADLTLMGEGHLSSPNSTFLPPPPT
PPGSAAPPRPGGGARGSRGLPVSTIVDVDRVAGSAPGPGSSIPGVWTGPRRSRAGGTLTS
DRPGLSPVLGGPAKPKAGPHHATFV
Download sequence
Identical sequences ENSTTRP00000014964 ENSTTRP00000014964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]