SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015093 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015093
Domain Number 1 Region: 19-170
Classification Level Classification E-value
Superfamily Globin-like 5.42e-44
Family Globins 0.000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015093   Gene: ENSTTRG00000015927   Transcript: ENSTTRT00000015927
Sequence length 190
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2909:885842:893912:-1 gene:ENSTTRG00000015927 transcript:ENSTTRT00000015927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKVPGEMEIERRERSEELSEAERKAVQATWARLYANCEDVGVAILVRFFVNFPSAKQYF
SQFKHMEEPLEMERSPQLRKHACRVMGALNTVVENLHDPEKVSSVLALVGKAHALKHKVE
PVYFKILSGVILEVIAEEFANDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATT
PPATLPSSGP
Download sequence
Identical sequences A0A1K0GGF6
XP_004275559.1.21590 XP_010949036.1.22495 XP_010982138.1.51371 ENSTTRP00000015093 ENSTTRP00000015093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]