SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015130 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015130
Domain Number 1 Region: 174-481
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.96e-83
Family Transglutaminase core 0.000000915
Further Details:      
 
Domain Number 2 Region: 6-172
Classification Level Classification E-value
Superfamily E set domains 8.05e-45
Family Transglutaminase N-terminal domain 0.00021
Further Details:      
 
Domain Number 3 Region: 501-612
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.38e-25
Family Transglutaminase, two C-terminal domains 0.0034
Further Details:      
 
Domain Number 4 Region: 614-712
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.000000000000262
Family Transglutaminase, two C-terminal domains 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015130   Gene: ENSTTRG00000015965   Transcript: ENSTTRT00000015965
Sequence length 718
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2177:294871:312913:-1 gene:ENSTTRG00000015965 transcript:ENSTTRT00000015965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQGEPSLLSTGLTGLSVAPPSLHVFIKRSRMDGLGIKSCDFQAARNNVEHHTNDISSQR
LIVRRGQPFTISLNFWAPIRTFLHTLKKVVLIAQTGEQPSKANQTQATFSISSLGDRKWW
SAMVEERDDQSWTISVTTPADAVIGHYSLLLQVSGRKQCLGQFTLLFNPWGREDAVFLAN
EAQRREYLLNQNGLIFLGTADCIQAEPWDFGQFEEDVIDLSLDLLSVDKRVEKWGNPVHV
ARVLGALLHALKEKSVLPTPQIQTTEEKALLNKRRGSAPILRQWVKGQGRPVYDGQAWVL
AAVACTVLRGLGIPARVVTTFTSAQGTGGGLLVDEYYSEEGLQNGEGHRGRIWIFQTSTE
CWMARPALPQGYDGWQILYPSAPNGGGVLEACDLVPVKAVKEGTLGLTPAVSDIFASINA
SCVVWKCHEDGTLELTDSNTKYVGNNISTKGVDCDRCEDITQNYKYPEGSLQEKEVLEKV
QENRMKHGKDDGIHPPSLETDDPLHFFLEAPSSLALGGDARFSVNLLNPSDHDKEVQLAV
GLQAVYYNGVLAANLWTKKLVLTLRANSAEKISTFLSFSNFKQNPPENSFLRLTAMATHS
SPTCFAQQDIAICRPHLAIEMPETAEQHQPLTASVSIHNSLDAPLKGCVISIFGRGLIHR
EKSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEMDCNMFQNLTNLRSVTVVAPETPA
Download sequence
Identical sequences ENSTTRP00000015130 ENSTTRP00000015130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]