SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015143 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015143
Domain Number 1 Region: 826-863
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000255
Family I set domains 0.046
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000015143
Domain Number - Region: 399-533
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000192
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number - Region: 120-204
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0036
Family Spectrin repeat 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015143   Gene: ENSTTRG00000015977   Transcript: ENSTTRT00000015979
Sequence length 869
Comment pep:known_by_projection scaffold:turTru1:scaffold_106723:23559:73592:-1 gene:ENSTTRG00000015977 transcript:ENSTTRT00000015979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECQANEFYQTDILXXXXXXXXXXXXXXXXEKQWQLFLKRSFLTQDLGLKFNLINMAKANE
ILNVKNEVHIMENTMESQKAEREELSRLRIAWQLKAAASKPVKQRWGAFKEQLRKTTHNL
KLLQEALMPVSALDLGGSLQTILGLQKKWNEMKPQFQQLNDEAQYIIKESEELSGKGAPV
KEKSQQLKDLIHLHQNQKERIQDYEEILYKIVQFHQVREELGRLFRSRELEFLQQPKETA
DAHDAQVLLSRSREKQAHIDHLHKLALSLGVDIISSVQRPNCSNVSAKHLQQQLDILEGD
SLNWRAQAEDHERALTHSLEFCTARDEMSLKESFKDIKKKFNNLKFNYTKKNEKARNLKA
LKYQIQQVDMYAEKLQALKRKMGKVENKIFFLNYPNNKVNVLLEAMRDLQKYVDEFDKVV
TDYRKNLDLTEHLQELIEECHFWYEDASATVVRVRKYSTECKTKEAVEILLQQFKKFITP
SVPQQEERIQEISDLAQRLYGFEEGQKYAEKIVAKHKEVLESVTELCSSLTELEEKKQGN
VLKMNLNLEGFHDDCIDLLKEPGRNKQTIFNKGRNKEQAKPADDLAVNKAGEGQVPREVK
QLVPGPEGAVQGLLLPVDVLSGEEYDCVSPDDVSLPPLPESPNSLLAPSDMELEARALPS
LHRHLSSHGMQTGTSGPGEAPESGLPPPAAFADACDDKRETFLSHFEKPSPQFQAEPPLT
SRRFPEESTDFHRISVKPPESMCGEVHARALQQHPQAQGSLLETPEKTHADNNVTKTRHR
LHASQDACSGLGFQPGPSQACQRQMVPREEIKVTSAKNSVVSLAGQAPNFSRLLSNVTVM
EGSPVTLEVEVTGFPEPTLTWWVAYNDKP
Download sequence
Identical sequences ENSTTRP00000015143 ENSTTRP00000015143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]