SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015150 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015150
Domain Number 1 Region: 1880-2013
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.06e-31
Family Ankyrin repeat 0.0000016
Further Details:      
 
Domain Number 2 Region: 785-918
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000439
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 3 Region: 1098-1239
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000165
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 497-611
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000126
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 594-717
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 375-498
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000033
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 7 Region: 908-1029
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000298
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 8 Region: 61-200
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000706
Family Growth factor receptor domain 0.0099
Further Details:      
 
Domain Number 9 Region: 1327-1363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000229
Family EGF-type module 0.02
Further Details:      
 
Domain Number 10 Region: 1237-1287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 1070-1112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000347
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 1456-1489
Classification Level Classification E-value
Superfamily Notch domain 0.0000000798
Family Notch domain 0.0035
Further Details:      
 
Domain Number 13 Region: 722-757
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000163
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 14 Region: 340-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000396
Family EGF-type module 0.017
Further Details:      
 
Domain Number 15 Region: 227-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000464
Family EGF-type module 0.011
Further Details:      
 
Domain Number 16 Region: 37-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000518
Family EGF-type module 0.038
Further Details:      
 
Domain Number 17 Region: 192-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 18 Region: 1041-1078
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000015
Family EGF-type module 0.033
Further Details:      
 
Domain Number 19 Region: 1375-1407
Classification Level Classification E-value
Superfamily Notch domain 0.00000209
Family Notch domain 0.0013
Further Details:      
 
Domain Number 20 Region: 1415-1447
Classification Level Classification E-value
Superfamily Notch domain 0.0000034
Family Notch domain 0.0065
Further Details:      
 
Domain Number 21 Region: 760-797
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000223
Family EGF-type module 0.032
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000015150
Domain Number - Region: 1280-1314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00357
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 278-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0219
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015150   Gene: ENSTTRG00000015980   Transcript: ENSTTRT00000015986
Sequence length 2308
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_270:28102:61112:-1 gene:ENSTTRG00000015980 transcript:ENSTTRT00000015986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGPRGRRRRRVMSPPPPLPSVRTLPLLLLLAGPSCLDGSPCANGGRCTQLPSREAACL
CPPGWVGERCQLEDPCHSGPCAGHGVCQSSVVAGTARFSCRCPRGFRGPDCSLPDPCLSS
PCAHGARCSVGSDGRYVCSCPPGYQGRSCRSDVDECRMGGPCRHGGTCLNTPGSFRCQCP
AGYTGPLCESPLVACAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDCPGHRCL
NGGTCVDGVNTYNCQCPPEWTGQCTXXXXXXXXXXXXXXNGGTCFNTLGHSCVCVNGWTG
ESCSQNDDCATAVCFHACHDRVAFYCCPMGKTGLLCHLDDACVSNPCHEDAICDTNPVNG
RAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCGRGYTGPRCETDVN
ECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDMDECQSSPCVNGGVCKDRVNGFSC
TCPSGFSGAMCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGTVCEHNVDDCSPDP
CHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDLVDKYLCRCPPGTT
GVNCEVNIDDCASNPCTFGICRDSINRYDCVCQPGFTGPLCNVEINECASSPCGEGGSCV
DGENGFQCLCPPGSLPPLCLPPSHPCAQEPCSHGVCHDAPGGFRCVCELGWSGPQCSQSL
ARDACESHPCWAGGTCTSDGTGFRCTCPPGVQGRQCELLSPCTPNPCEHGGYCESAPGQP
AVCSCPPGWQGSRCQQDVDECAGPSPCGPHGTCANLAGSFSCTCHEGYSGSSCDQDIDDC
DPNPCLNGGSCQDGVGSFSCSCLPGFAGPRCARDVDECLSSPCGPGTCTDHVASFTCTCP
PGYGGFLCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRLGYTGTHCQHEADPCLSRPCLH
GGVCTAAHPGFRCACPEGFTGTQCQTLVDWCSRTPCQNGGHCARTGASFYCLCPSGWSGR
LCDIQSLPCREAAAQIGVPLEQLCQAGGQCVDKDSSHYCVCPEGHTGSHCEQEVDPCLAQ
PCQHGGTCRGYMGGYVCECPAGYTSDNCEDDMDECASQPCQHGGVCIDLVARYLCSCPPG
TLGVLCEINEDDCGPGPPLDPGPRCLHNGTCVDLVGGFRCTCPPGYTGLRCEADINECRP
GACHAAHTRDCLQDPGGGFHCLCHAGFTGPHCQTVLSPCESQPCQHGGQCHPNPGAGGAL
TFSCHCVPPFSGPRCERVARSCWELQCPVGVPCQQTVRGPRCACPPGLSGPACRGSRGST
LGAANASCVTSPCLHGGSCRPETLAPFFRCACASGWAGPRCEIPAAVPEAPEEPSCPRAA
CEAKSGDKRCDRKCNSPGCGWDGGDCSLSVSDPWRQCAALQCWLLFNNSRCDPACSSPAC
LYDNFDCRAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCAGEVPALLARG
VLVLTVLLPPEELLRSSADFLQRLSGILRTSLRFRLDENGQAMVFPYHRPGPGSESRNRR
ELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFPYPLRAARG
EPLELPEPSVPLLPLLAASAVFLLVILVLGVMVARRKREHSTLWFPEGFALHKDAAAGHK
GRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGVGAEDAVDCRQWT
QHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXILIRNRSTDLDARMADGSTALILAARLAVEGMVEELIASHAD
VNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAAREGSFEAAKLL
LDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGLGPLLCPPGAFLP
GLKVAQSGGKKSRRPPGKAGLGPQGTRGRGKKLTLACPGPLAESSVTLSPVDSLDSPRPF
GGPPASPGGFPLEGPYAAAAATAVSLAQLGGAGRAGLGRQPPGGCVLSLGLLNPVAVPLD
WARLPPPAPPGPSFLLPLAPGPQLLNPGNPVSPQERPPPYLAAPGHGDEFPASGAHSSPP
KARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSDSTPSPATATGATAAGTLSAQPLP
LSVPGPLAQSQTQLGSQPEVTPKRQVLA
Download sequence
Identical sequences ENSTTRP00000015150 ENSTTRP00000015150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]