SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015238 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015238
Domain Number 1 Region: 18-124
Classification Level Classification E-value
Superfamily PH domain-like 2.28e-32
Family Pleckstrin-homology domain (PH domain) 0.00022
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000015238
Domain Number - Region: 198-269
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000167
Family BCR-homology GTPase activation domain (BH-domain) 0.025
Further Details:      
 
Domain Number - Region: 627-736
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00068
Family FCH domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015238   Gene: ENSTTRG00000016079   Transcript: ENSTTRT00000016078
Sequence length 748
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1532:374432:611615:1 gene:ENSTTRG00000016079 transcript:ENSTTRT00000016078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEESNDSMENPQQGQGRNNAMKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPL
GTIFLPGNKVLEHPCNEESPGKFLFEVVPGGDRDRMTANHESYLLMASTQNDMEDWVKSI
RRVIWGPFGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXNTDVHTVASLLKLYLRXXXXXXXXXXXXXXXXXXXXXXXX
XXXXGVKGLAKQVKSLPVVNYNLLKYICXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXTVVVQQLMSMMISKHDRLFPKDAELQSKPQDGVSNNNNDLQKKATMGQLQ
NTENNNTKDSPGRRCSWDKSESPQRSNMDNGSPTALSGSKTNSPRNSVHKLDVSRSPPLM
VKKNPAFNKGSGIVTNGSFSSSNAEGLEKAQTTPNGSLQSRRTSSLKGSGTKMGTHSVQN
GTVRMGILNTDTLGNPVNGRSMSWLPNGYVTLRDNKQKEQAGESGQHNRLSTYDNVHQQF
SVMSLDDKQSIDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFYGGNFEDPVLDGPPQD
DLSHPGDYENKSDRRSVGGRSSRATSSSDNSETFVGHTSNHSALHSLVSSLKQEMTKQKI
EYESRIKSLEQRNLSLETEMMSLHDELDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQK
EMEQFFSTFGELTLEPRRTERGNTIWIQ
Download sequence
Identical sequences ENSTTRP00000015238 ENSTTRP00000015238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]