SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015303 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015303
Domain Number 1 Region: 383-603
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-54
Family DBL homology domain (DH-domain) 0.0000998
Further Details:      
 
Domain Number 2 Region: 964-1034,1073-1184
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000025
Family WD40-repeat 0.072
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000015303
Domain Number - Region: 635-694
Classification Level Classification E-value
Superfamily PH domain-like 0.00231
Family Pleckstrin-homology domain (PH domain) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015303   Gene: ENSTTRG00000016134   Transcript: ENSTTRT00000016145
Sequence length 1340
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_631:30330:121156:1 gene:ENSTTRG00000016134 transcript:ENSTTRT00000016145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFHVRDPAQERWSGSMDQPGPPAPAREENEVKYDTNNNEEEEGEQLDLDGVDEAPEADRR
APGAPEARDTGADAPRPTHENGTGADTDALAEPLRPGVPTRVNPYSVIDITPLHEDQPAS
GPGAEGEGGGLHVPSGYSVPVPCGYAVPSGLPLLLPAYSSPALTPAETQEGAEDSQLNSL
SSEDPTNSEGPVHKEDSALARWVADPANTAWMENPEEAIYDDVPRENSDSEPDEMIYDDV
ENGDEGGNSSLEYGWSSSEFESYEEQSDSESRNGVPQCFLRSDHKKQLSHDLTRLKEHYE
KKMRHLVANAVGAVEIQQLKHKHELKMQKLVKAAKEGTKDGLEKTKAAVKRGRSFIRTKS
FAHRPCLEEEQNLFIDVDCKHPEAVLTPMPEGLSQQQVVRRYILGSVVDSEKSYVDALKR
ILEQYEKPLSEMEPKILSERKLKTVFYRVKEVLQCHCMFQIALASRVAEWDSVEMIGDVF
VASFSKSMVLDAYSEYVNNFSTAVAILKKTCATKPAFLEFLKQCQEASPDRVTLHSLMMK
PIQRFPQFILLLQDMLKNTPRGHPDRLPLQMALTELETLAEKLNERKRDADQRCEIKQIA
KAINERYLNKLLSSGSRYLVRSDDVVETVYNDRGEIVKTKERRLFMLNDVLMCATVSSRT
SHDSGALTSTGQRYLLKWSVPLGHVEVIEYGGGEGAGENGRGPVVPAPESLAVVAGAKPN
RVYMGPGQLYQDLQNLLHDLNVIGQITQLVGNLKGNYQXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEENHL
GWFYVEDDGNQIKKERHPLLVGHMPVTVAKQQEFKIECAVYNPEPYLNNENQPDSFSTAH
GFLWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRVLCMVYVPAEDRPREPESTGGRVL
GIPTVCLGTEEGSISIYKSSQGSKKVRLQHFFTPEKSTVMSLACTPQSLYAGLVNGAVAI
YARADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQLEAHQ
EEGMVVSHMAIAGVGIWIAFTSGSTLRLFHTETLKHLQDVNVATPVHHMLPGHQRLSVTS
LLVCHGLLMVGTSLGVVVALPVPRLQGIPKVTGRGLVSYHAHNGPVKFLVVATAASKADR
DKPRDSPPPGTDPQDEDQRDTLPGEGPGPCPSRSGPDAVWLGASLGSLAQASDVSSTSGS
PTPSQGSGSLGPRSEESFVQDPLRLPAPPRGRRARKAKASSVLVACGGQGHRRVSRKARQ
QRPEELASSVMVWQIPLLNV
Download sequence
Identical sequences ENSTTRP00000015303 ENSTTRP00000015303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]