SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015386 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015386
Domain Number 1 Region: 1-313
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.8e-105
Family Transglutaminase core 0.0000000386
Further Details:      
 
Domain Number 2 Region: 351-462
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.59e-24
Family Transglutaminase, two C-terminal domains 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015386   Gene: ENSTTRG00000016230   Transcript: ENSTTRT00000016230
Sequence length 565
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_614:6942:31749:-1 gene:ENSTTRG00000016230 transcript:ENSTTRT00000016230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DAVSLDGEPQRQEYVVNDYGFYQRNKNWICPCPWNYGQLEENIIDICLELLDKSLNFQID
PATDALRGSPVHVSRVVCAMINSNDDRGVLNGDRSENYADGINPVEWTGSVAILKQWHAT
VCQPVCYGQCWVFAAVMCTVMRCLGIPTQVITNFDSGHDTDGNLIVDEYNDNTGRTLESK
KDSVWNFHVWNECWMARNDLPPGYRGWQVLDATPQEMSNSLYCYGPASIRAIKEGEVDLN
DTAFAFSMVNADCMAWLVFGGKEQKLHLDTNSVGNFISTKRIQSDERDDVTENCKYGEGS
LQERQVILKALQKLKPGRSQGSLQQTSRSMLPRDSPRSLATPSLRPSDVVQVSLTFQLLD
PPDMGRDIRFVLLALNTAPQFKDLKVNLSAQSLLHDGSPLPPFWQDTAFITLSPEEAKTY
PCKIPYSQYGQYLSTDKLIRISALGEEKSSPEKTVVNKIITLACPGIMINXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXSSNKFKDHKGYRNVYVDFGL
Download sequence
Identical sequences ENSTTRP00000015386 ENSTTRP00000015386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]