SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015396 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015396
Domain Number 1 Region: 114-243
Classification Level Classification E-value
Superfamily SH2 domain 4.31e-24
Family SH2 domain 0.00075
Further Details:      
 
Domain Number 2 Region: 35-161
Classification Level Classification E-value
Superfamily SH3-domain 0.000000016
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015396   Gene: ENSTTRG00000016240   Transcript: ENSTTRT00000016240
Sequence length 256
Comment pep:novel genescaffold:turTru1:GeneScaffold_527:12304:25769:-1 gene:ENSTTRG00000016240 transcript:ENSTTRT00000016240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPFFRKLLTFLSFFWDKIWPAGRGSNPDSDADVEPEPAAAEPPTAEPCNPPAQLFRADF
TARSAEDLSVSRGERLHALREEGGYILARRLAGWPSTGLVPITYVANKAAPETLWNQPEY
FSGISRTQAQQLLLPPPSALGAFPVRPSESSHGDYSLSVWARTKVHHYSIPTAATGSLSL
QKDQHVPSLEELLAYCKAHWKLRQPCEPQKPPEQDEWQRPRSAFTLRRKLGEGYFGEVWE
GLWLDSMLVAVKVIRP
Download sequence
Identical sequences ENSTTRP00000015396 ENSTTRP00000015396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]