SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015469 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015469
Domain Number 1 Region: 112-276
Classification Level Classification E-value
Superfamily PH domain-like 2.28e-23
Family Pleckstrin-homology domain (PH domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 49-85
Classification Level Classification E-value
Superfamily WW domain 0.00000000579
Family WW domain 0.0025
Further Details:      
 
Domain Number 3 Region: 9-43
Classification Level Classification E-value
Superfamily WW domain 0.00000267
Family WW domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015469   Gene: ENSTTRG00000016320   Transcript: ENSTTRT00000016320
Sequence length 1115
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_785:59831:260023:-1 gene:ENSTTRG00000016320 transcript:ENSTTRT00000016320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVGRDTLLEHWSYGVCRDGRVFFINDQLRCTTWLHPRTGEPVNSGHMIRSDLPRGWE
EGFTEEGASYFIDHNQQTTAFRHPVSGQFSPENSEFILQEEPNPHMSKRERNQRPSSMVS
ETSTAGTTSTVEAKPGPKIIKSSKVHSFGKRDQAIRRNPNVPVVVRGWLHKQDSSGMRLW
RRWFVLAYCLYYKSREEVVLGSIPLPSYVISTVAPEDRISRKYSFKAVHMGMRALIYNSS
TRGSQAEQSGMRTYYFSADTQEDMNAWVRAMNQAAQVLSRSSLKRDMEKVERQAVPQANH
TESCRECGRVGPGHARDCSHRKREDSFGFERREQEEDRYRSQRDPLEGKRDRSKARSPYS
PTEEDALFVDLPCGPRGQQAQPQRAERNGVLPGTSGPGEQNGTGGYQRVFPSRTNAEKHS
QRKSSLAHVEQWAKTQKADGRSLPLDQTLPRHGPSQSLSFPENYQTLPRSSRHPSGGSSP
PPRNLPSDYKYAQDRASHLKMSSEERRAHRDGTVWQLYEWQQRQQFRHGSPTAPICAGSP
EFTDQSRSRSMLEVPRSISVPPSPSDIPPPGPLRAFPPRRPHTPAERVTVKPPDRRRSVD
ISLSGSPRKTWGHTTKNSSHLDRRSMPSMGYMTHTVSAPSLHGKSADDTYLQLKKDLEYL
DLKMTGRDLLKDRSLRPVKIAESDIDVKLSVFCEQDRILQDLEDKIRALKENKDQLESVL
EVLHRQMEQYRDQPQHLEKIAYQQRLLQEDLVHIRAELSRESTEMENAWNEYLKLERDVE
QLKQTLQERHRRAFFFQEKSQIQKDLWRIEDVTAGLSANKENFRILVESVKNPERKTVPL
FPYPPVPSISSSESKPSLLPSPPTSPMRTPLEVRLFPQLQTYVPYRPHLPQLRKVMSPLQ
SPTKTKPKVEDEAPPRPPLPELYSPEDQPPAVPPLPREATIIRHTSVRGLKRQSDERKRD
REQGQCVNGDSRVELRSYVSEPELATFSGDMAPPSLGLVGSESRYQTLPGRGLSGSTSRL
QQSSTIAPYVTLRRGLDAESSKVTYPRPRSALERLYSGDHQRGKMSAEEQLERMKRHQKA
LVRERKRTLSQGERTGLPSSRYLGQPLPGDLGSVC
Download sequence
Identical sequences ENSTTRP00000015469 ENSTTRP00000015469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]