SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015483 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015483
Domain Number 1 Region: 123-299,337-364
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.94e-35
Family WD40-repeat 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000015483
Domain Number - Region: 494-536
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0118
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015483   Gene: ENSTTRG00000016335   Transcript: ENSTTRT00000016335
Sequence length 539
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_736:342315:349285:-1 gene:ENSTTRG00000016335 transcript:ENSTTRT00000016335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAGTAATPGPESQERPERAAERPGPRRRGHHERQFRCPDASLGPQRTPTPSAEKSQR
ERPSAGPGPAMSRRVVRQSKFRHVFGQAAKADQAYEDIRVSKVTWDSSFCAVNPKFLAII
VEAGGGGAFIVLPLAKTGRVDKNYPLVTGHTAPVLDIDWCPHNDNVIASASDDTTIMVWQ
IPDYTPVRNITEPILTLEGHSKRVGILSWHPTARNVLLSAGGDNVIIIWNVGTGEVLLSL
DDIHPDVIHSVCWNSNGRLLATTCKDKTLRIIDPRKGQVVAERFANHEGMRPMRAVTRQX
XXXXXXXXXXXXXXXXXXXXNNFEEPVALQEMDTSNGVLPFYDPDSSIVYLCGKGDSSIR
YFEITEEPPFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERKCEPIIMTVP
RKSDLFQDDLYPDTPGPEPALEADEWLSGQDAEPVLISLRDGYMPPKHRELRVTKRNILD
VRPPPGPRRSQSASDAPLSQHTLETLLEEIKALREQVQAQEQRITSLENMLCELVDGTD
Download sequence
Identical sequences ENSTTRP00000015483 ENSTTRP00000015483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]