SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015485 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015485
Domain Number 1 Region: 1037-1134
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000379
Family GAF domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000015485
Domain Number - Region: 285-349,383-465
Classification Level Classification E-value
Superfamily EF-hand 0.000989
Family Calmodulin-like 0.037
Further Details:      
 
Domain Number - Region: 826-917
Classification Level Classification E-value
Superfamily EF-hand 0.00528
Family Calmodulin-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015485   Gene: ENSTTRG00000016337   Transcript: ENSTTRT00000016337
Sequence length 1504
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_736:615126:712860:1 gene:ENSTTRG00000016337 transcript:ENSTTRT00000016337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESTSQEEPKPAQENGKEDKERNQEATKVKEPMKSRSIPDSLALGICSNVAGTAANKVK
SQELNLEQPKISTCSLEDSRISKNTVFRKPAEVIFNLDQTAQNSKLEQSWKKNLFERVQA
RAQAMQQKIIDKENLKKELEKKAEEKLPTDNLAKEWFSTENMTLNTRAYLLDKLLPTLVP
GMEKMLMQVEKKKLLAEVDIPTKFDPINHLGEYLMRNNPNYIKDSGMSGYQRVMRNIAED
LKINVPSTTYNRVSRMKENIKQKREQIECMNKVKAKVANTWKQALQEQFNEWILDPKGMI
PMIVIQNVLHEFFQNPDFQLEACCQQLDIADSMEPRLNKMEFIEFIYSHIAGFKSEMFEE
LLKHLCHCADEFREVIKTDMRRQMFAELFLHCDHGKVGFLDRQRTLALLETFYDQSSKVL
RGLLRNPRQWPFVEFGEIDLPEFWGDMDNQKHIYEDFDKVLLEMNTLHASKHTKHASKSQ
SKLLANPEDQHKHDKHRKSTLPQSPPEQQRGTTANQEPNRISTKEQDKESTGEQELNKES
VAKRRTYTGSTPEQGSSRELIIEQRPHIESITEQGEPPGIHTEPAAEQGLYRESVTAQGQ
HEESTTGQGSHRGSPEEQGPHRESVLEQGPHRGSVAEQGAHRESVVEQGPLRGSTAEQQP
PIETIPEKQEDIDSTSQSRKGSILRESEKSREAISFEYTEILPQEERTQGQIYEEQLFMS
PELQEKISVSSRKGHLSETEKKEVQRDKSCEPKSQKIEGKSWSGELLTCNWNTKYAKCEE
EEQANLIYGNSRFTDLHSMIRNIQSYKEIKGRSAFNGVSFNLLQFVQLLETFVGEDAPLS
VSEALTSFFKKGFVETKEEKRSGLEEARQNASQVRRGLLLNALFQKWDCDSSGFLDLNEV
DELLYTYKEGMEKESMKKAKLHIQFPKPHPGHEVRLSSKQFQKYIELVVSELRGNEDQVL
ESVVEFLMNTLERSRVESLRNCARQKWLHQIQRAAETSGVSLEPVYAETFKALTQDAEAH
GNKKISAHISLLEENLLLPDRGKVLLKNIACTLDDAPFVLNKVLYRDMKGISFTVVDEGK
PIHVPQVQNHGNIFFWNHSRKKNDQNGSFLALPLQDAYMRIFGVLAVDTLRDPQKINIFL
PHEIKFYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXD
SDYVLRNMMVTGHLGLTEIHRNPPIIFRKTCIFRDFLFKCTDSSEVVLASVCGENHIVVP
LRERTGEALGALDVNIGRSKMLLYREFKDLQKMTKVIQVACNEILGELSGEIKKNYILEI
ENVGAVQRAGILFFRVMLKELQQCLRLLTSMDFVSLLLYDYDLLAEPKSPDSQSQELEAN
IRLVQDILKIILFFHPELELSSDLGWDQCKLXXXXXXXXXXXXXXXXXXXXXXXXXXXDE
YIRDHSRIEVWTFGNTAIEYLYHWAHICSALMKLNKKINSAISPPLPSETDSYVYKMPGG
SLLG
Download sequence
Identical sequences ENSTTRP00000015485 ENSTTRP00000015485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]