SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015516 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015516
Domain Number 1 Region: 99-265
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.27e-21
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 2 Region: 5-81
Classification Level Classification E-value
Superfamily F-box domain 3.53e-18
Family F-box domain 0.0039
Further Details:      
 
Domain Number 3 Region: 280-349
Classification Level Classification E-value
Superfamily ApaG-like 5.62e-18
Family ApaG-like 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000015516
Domain Number - Region: 421-451
Classification Level Classification E-value
Superfamily ARM repeat 0.0132
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015516   Gene: ENSTTRG00000016372   Transcript: ENSTTRT00000016372
Sequence length 471
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1074:682217:714294:-1 gene:ENSTTRG00000016372 transcript:ENSTTRT00000016372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVETESAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKY
WLISEEEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKE
GAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTA
AGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFI
IGATFTDWFTSYVNNVVSGGFPIIRDQIFRYVHDAECVATTGDITVSVSTSFLPELSSVH
PPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEMGPDEY
EEMEEEEEEEEEEDDDDDSADMDESDEDDEEERRRRVFDVPIRRRRCSRLF
Download sequence
Identical sequences ENSTTRP00000015516 ENSTTRP00000015516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]