SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015569 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015569
Domain Number 1 Region: 629-739
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-19
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 2 Region: 448-569
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-18
Family Spermadhesin, CUB domain 0.0029
Further Details:      
 
Domain Number 3 Region: 746-811
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000148
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 279-396
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000353
Family Spermadhesin, CUB domain 0.0056
Further Details:      
 
Domain Number 5 Region: 805-867
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 6 Region: 394-455
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000181
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 7 Region: 568-629
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000723
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 8 Region: 873-929
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000216
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015569   Gene: ENSTTRG00000016424   Transcript: ENSTTRT00000016425
Sequence length 1025
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_485:75767:252740:1 gene:ENSTTRG00000016424 transcript:ENSTTRT00000016425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAARPPAAGLGRIALLLALLLGSPAAAPAEDAPLEGDAGPSGTYFLPLEALGSSSLSHE
TPKERVTTAPLNPAQSGDELHKPELEGMVPSAPQDSAAASMLLPLPEEPGTGHAFPPTKK
PPSLKQVNLTRRQLRPKATTAAAVQRAASQPASSDLVLLSSATEKLRPPGDQDPVASAGA
SEEPLWLEQKEGAVPTTPAPLQIAPFTSQPLVAHTLPQSPDPGAPAVPEEAHEAPPGDAS
PMTLMDKCENELTGSASEESQETTTSTIITTTVITTEQAPALCSVSFSDPEGYIDSSDYP
PLPLNNFLECTYNVTVYTGYGVELQVKSVNLSEGELLSIRGVDGPSLTILANHTLLVEGQ
VIRSPTNTISVYFRTFQDDGLGTFQLHYQAFMLSCNFPRRPDYGDVMVMDLHSGGVAHFH
CHLGYELQGAKTLTCINASKPHWSSQEPICSAPCGGAVHNATIGRVLSPSHSGNTNGSQF
CVWTIEAPEGQKLHLHFEKLSLHEKDRMMVYSGLTNKSTLLYDSLQTENVPFEGLLSDGH
TICIEFTSDQGRVASAFNIRFEAFEKGHCYEPYIQNGNFTTSDPTYNIGTIVEFTCDPGH
SLEQPAIIECINVRDPYWNDTEPLCRAMCGGELSAVAGVVLSPNWPEPYVEGEDCVWKIH
VGEEKRIFLDIQXXXXXXXXXXTIYDGDEVMPHILGQYLGNSGPQKLYSSTPDLTIQFHS
DPAGLIFGKGQGFIMNYIEVSRNDSCSDLPEIQNGWKTTSHTELVRGARITYQCDPGYDI
VGSDTLTCQWDLSWSSDPPFCEKIMYCTDPGEVDHSTRLISDPVLLVGTTIQYTCNTGFV
LEGSSLLTCYSRETGTPIWTSRLPHCVSEESLACDNPGLPENGYQILYKRLYLPGESLTF
MCYEGFELMGDVIIPCILGQPSPWNGPLPXXXXNQDSFEHALEVAEAAAETSLEGGNVAL
AIFIPALLISLLLGGAYIYITRCRYYSNLRLPLMYSHPYSQITVETEFDNPIYETGETRE
YEVSI
Download sequence
Identical sequences ENSTTRP00000015569 ENSTTRP00000015569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]