SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015745 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015745
Domain Number 1 Region: 633-719,1023-1267
Classification Level Classification E-value
Superfamily Ras GEF 1.83e-84
Family Ras GEF 0.0000856
Further Details:      
 
Domain Number 2 Region: 222-443
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-44
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 3 Region: 24-154
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-19
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 
Domain Number 4 Region: 432-586
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000067
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015745   Gene: ENSTTRG00000016608   Transcript: ENSTTRT00000016608
Sequence length 1270
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2230:163787:263806:-1 gene:ENSTTRG00000016608 transcript:ENSTTRT00000016608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPTLSAKEPLEKQHYFTVNFSHENQKALELRTEDARDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEIAS
LLKDNERIQSTQTVTPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEAKGSG
QDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKPMAASHCRRQGAKMIRSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLL
ERLTDLRFLSIDFLNTFLHSYRVFTTAVVVLDKLITIYRKPISAIPARWAGSLELLFASG
QNNKLLYGDPPKSPRATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSC
NSNGYTSMYSAMSPFSKATLDTSKLYVSSSFASKIPDEGDMSAEKPEESSAPSKQSSEVS
MREESDNDQNQSDEGDTETSPTKSPTTPKSVKSKNSSXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGWMLQKERPYIMTT
KHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFR
LKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEG
TPNYTEDGLVNFSKMRMXXXXXXXXXXXXXXXXXXXXXXXVTQYLLDQSFVMDEESLYKC
SLRIEPKLPT
Download sequence
Identical sequences ENSTTRP00000015745 ENSTTRP00000015745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]