SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015748 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015748
Domain Number 1 Region: 136-345
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-54
Family DBL homology domain (DH-domain) 0.0000619
Further Details:      
 
Domain Number 2 Region: 356-479
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-19
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015748   Gene: ENSTTRG00000016611   Transcript: ENSTTRT00000016611
Sequence length 558
Comment pep:known_by_projection scaffold:turTru1:scaffold_102154:1593:268559:1 gene:ENSTTRG00000016611 transcript:ENSTTRT00000016611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSRVMNQCVFREMEENKERPKRQRQNNFPTFPSPKAWNFRGRKRKQSAQDEDAISLCS
LDISEPSNKRVKPLSRVTSLANLIPPVKATPLKRFSQTLQRSISFRSESRPDLLAPRPWS
RNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIKRQEAIFELSQGEEDLIEDLKLAKKAY
HDPMLKLSIMTEQELNQIFGTLDSLIPLHEDLLSQLRDVRKPDGSTEHVGPILVGWLPCL
SSYDSYCSNQVAAKALLDHKKQDHRVQDFLQRCLESPFSRKLDLWNFLDIPRSRLVKYPL
LLREILRHTPNDNPDQQHLEEAINIIQGIVAEINTKTGESECRYYKERLLYLEEGQKDSL
IDSSKVLCCHGELKNNRGVKLHVFLFQEVLVITRAVTHNEQLCYQLYRQPIPMKDLLLED
LQDGEVRLGGSLRGAFSNNERIKNFFRVSFKNGSQSQTHSLQANDTFNKQQWLNCIRQAK
ETVLCAAGQAGVLDSEGPFLDPTTGSREPQGETKLEQMDQSDSESDCSMDTSEVSLDCER
MEQTGSSCGDSRHVESNV
Download sequence
Identical sequences ENSTTRP00000015748 ENSTTRP00000015748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]