SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015753 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015753
Domain Number 1 Region: 468-601
Classification Level Classification E-value
Superfamily TIMP-like 1.71e-37
Family Netrin-like domain (NTR/C345C module) 0.01
Further Details:      
 
Domain Number 2 Region: 285-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000138
Family Laminin-type module 0.053
Further Details:      
 
Domain Number 3 Region: 404-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 4 Region: 95-175
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000118
Family Galactose-binding domain 0.046
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000015753
Domain Number - Region: 155-226
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0706
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015753   Gene: ENSTTRG00000016618   Transcript: ENSTTRT00000016617
Sequence length 604
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_195:22514:201237:1 gene:ENSTTRG00000016618 transcript:ENSTTRT00000016617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRAVWEALAALAAVACLVGAVRGGPGLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAF
GKDVRVSSTCGRPAGRYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCW
QSENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQ
CRKMYNRPHRAPITKQNEQEAVCTDSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQD
WVTATDIRVAFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRDRDD
SLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXNKSGPHNPYCKEGHYRDLGKPITHRKACKACDCHPVGAAGKTCNQTT
GQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASK
GKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQNLWIRSR
DIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGK
CKKA
Download sequence
Identical sequences ENSTTRP00000015753 ENSTTRP00000015753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]