SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015815 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015815
Domain Number 1 Region: 45-511
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.97e-103
Family L-arabinose binding protein-like 0.000000107
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000015815
Domain Number - Region: 521-581
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00366
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015815   Gene: ENSTTRG00000016681   Transcript: ENSTTRT00000016681
Sequence length 924
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3271:74458:1079647:1 gene:ENSTTRG00000016681 transcript:ENSTTRT00000016681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQLGKLLRALTLMKFPCCVLEVLLCALAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAK
GPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSL
TFVQALIQKDTSEVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYA
STAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQ
ISKEAGGLCIAQSVRIPQERKDRTIDFDKIIKQLLDTPNSRAVVIFANDEDIKQILAAAK
RADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKRATVEXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQERIGKDSTYEQEGKVQFVIDAVYAMAH
ALHHMNKDLCADYRGVCPEMEQAGGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIF
QYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGLREIPPSVCTLPCKPGQRKKTQKGTP
CCWTCEPCDGYQYQFDEMTCQHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAML
GIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRV
FLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIW
FGVDPPNIIIDYDEHKTMNPEQARGVLKCDITDLQIICSLGYSILLMVTCTVYAIKTRGV
PENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGML
YMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNT
FLFGCTVELLHFKLAFSRNQSNLW
Download sequence
Identical sequences ENSTTRP00000015815 ENSTTRP00000015815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]