SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015840 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015840
Domain Number 1 Region: 583-885
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 6.28e-83
Family Oxysterol-binding protein 0.0016
Further Details:      
 
Domain Number 2 Region: 17-143
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-19
Family Pleckstrin-homology domain (PH domain) 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015840   Gene: ENSTTRG00000016707   Transcript: ENSTTRT00000016707
Sequence length 887
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_672:271869:352966:-1 gene:ENSTTRG00000016707 transcript:ENSTTRT00000016707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSDEKSLGVSPKLASPSRSTSSCSSKQGSRQDSWEVVEGLRGEVNYTQEPPIQKGFLLK
KRKWPLKGWHKRFFYLDKGILKYAKNQSDIEREKLHGCIDVGLSVMSVKKSSKCIDLDTE
EHIYHLKVKSEEVFDEWVSKLRHHRIYRQNEIAMFPHEVNHFFPGSAVTDSGSEVLDTIS
SRKHSGISKQNSFQTGSNLSFSCGGETRVPLWLQSSEDMEKCSKELANCHDCLVEMSQLL
QSMDVLHRTYSAPAINVIQGGSFESPKKEKRSHRRWRSRAVGKDAKGTLQVPKTFSGPVR
LHSSNPNLSTLDFGEDKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSAFNTISTEREK
LKQLMEQDVSVSPSAQVLGLKHALSSALAQNTDLKERLCRIHAESLLLDRPVAAKSGDRL
AEENSRDDNRTLVHQLSNESRLSITDSLSEFFDAQEVLLSPSSSENEMSEDDSYVSDISD
NLSLDNLSNDLDNERQTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVYVAAFAVSAYASSYFRA
GSKPFNPVLGETYECIREDKGFQFFSEQVSHHPPISACHAESGNFVFWQDMRWKNKFWGK
SMEIVPIGTTHVTLPAFGDHFEWNKVTSCIHNILSGQRWIEHYGEIVIKNVNDDSCHCKV
NFIKAKYWSTNAHEIEGTVFDKSGKAVHRLFGKWHESIYCGGSSSSTCIWRAXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLEEGSLEEAEIQKQRIEQLQRERR
RVLEENKVEHQPRFFRKSSDDSWVSSGTYLELRKDLGFSKLDHPVLW
Download sequence
Identical sequences ENSTTRP00000015840 ENSTTRP00000015840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]