SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015863 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015863
Domain Number 1 Region: 15-109
Classification Level Classification E-value
Superfamily Histone-fold 1.7e-28
Family Nucleosome core histones 0.0000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015863   Gene: ENSTTRG00000016733   Transcript: ENSTTRT00000016730
Sequence length 110
Comment pep:novel scaffold:turTru1:scaffold_96574:30587:46884:1 gene:ENSTTRG00000016733 transcript:ENSTTRT00000016730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKGGKGLAKAKTRSSPAGLQFPVGRVHWLLRKGNYSKRVGVGAPVYLTAEILELAG
SPTRDKTRVIPRHLQLAIYKEEEFNKLLGKVTIAQGGVLPNIQAVLLPRR
Download sequence
Identical sequences ENSTTRP00000015863 ENSTTRP00000015863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]