SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015892 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015892
Domain Number 1 Region: 176-492
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.6e-126
Family Transglutaminase core 0.0000000000218
Further Details:      
 
Domain Number 2 Region: 499-615
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 8.89e-30
Family Transglutaminase, two C-terminal domains 0.00000235
Further Details:      
 
Domain Number 3 Region: 616-715
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.85e-28
Family Transglutaminase, two C-terminal domains 0.0000048
Further Details:      
 
Domain Number 4 Region: 67-174
Classification Level Classification E-value
Superfamily E set domains 1.05e-26
Family Transglutaminase N-terminal domain 0.00000346
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015892   Gene: ENSTTRG00000016755   Transcript: ENSTTRT00000016761
Sequence length 717
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3457:464240:495959:-1 gene:ENSTTRG00000016755 transcript:ENSTTRT00000016761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTVGLSLCIARCWSHLESPATGLKSSHHPTMAEDLVLERCDLXXXXXXXXXXXXXXXXXX
XXXXXAQPFWLTLHFEGRNYEAGVDSLTFCAVTGPAPSEDAGTKARFGLSDAVEEGAWAA
TVVDQQDSALSLQLRTPASSPIGLYRLSLEASTGYQGSSFVLGHFTLLFNAWCPADAVYL
DSEEERREYVLTQQGFIYQGSAKFINRIPWNFGQFEDGILDICLMLLDVNPKFLRNAGRD
CSRRSSPVYVGRVVSAMVNCNDDQGVLLGRWDNNYRDGISPMFWIGSVDILRRWKNDSCQ
RVKYGQCWVFAAVACTVLRCLGVPTRVVTNYNSAHDQNSNLLIEYFRNEFGEIQSDKSEM
IWNFHCWVESWMTRPDLQPGYDGWQALDPTPQEKSEGTYCCGPVPVRAIKVGDLSPKYDA
PFVFAEVNADVVDWIRQDDGSMHKSINHSLVVGQKISTKSVGRDEREDITHTYKYPEGSA
EEREAFTRANRQNKLADKEETGVAMRIRAGQGMNRGSDFDVFAHITNNTAEDHAGCLLLC
ARTVSYNGILGPKCGTKDLLNFSLEPFSEKSIPLRILYERYCDYLTESNLIKVRGLFVEP
AANSYLLAERDIYLENPEIKIRILGEPKQNRKLVAEVSLWNPLTVPLSGCTFTVEGAGLT
KEQKTVEIPHPVEAGEEVKARVDLLPLNAGRHKLVVNFESDRLKAVKGFRNVIVNTS
Download sequence
Identical sequences ENSTTRP00000015892 ENSTTRP00000015892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]