SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015914 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015914
Domain Number 1 Region: 168-278
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000174
Family Link domain 0.013
Further Details:      
 
Domain Number 2 Region: 267-325
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000112
Family Complement control module/SCR domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015914   Gene: ENSTTRG00000016786   Transcript: ENSTTRT00000016786
Sequence length 700
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3044:363714:402414:-1 gene:ENSTTRG00000016786 transcript:ENSTTRT00000016786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRVPAGGGSLQRALRSPRLHAPFRSAPRHPGSSPFGSASFGTEAPRCPARRRSPATAASP
APSTGPPGARPQRCGSASPAPGSPRSSLSAVRARSLRRANRAQHAELSGVRGAVARALPS
TARARAPASPMDVRTMSAKGPGSRTRLWAAALLLLGLPGLSLRAEGKLFVLESQNGSQGL
ELEAARLSCKSRGAHLVSADELRKVVRDCAFSVCTTGWLADGSLGTTMCSKGSGEQQIMR
AVDVRIESNPVPGGTYNALCIKDEEKPCGDPPSFPHTILQGHTGLEMGDELLYLCAPGHV
TGRRETAFTLLCNSCGEWYGLVQACGKDEGEVHIDYEDNFPDDRSVSFRELMEDSRTEAE
EDRGQGEASEEAPEQDHLVSISVGKEDTAQDTAFAPTTGLPSTGSGVPTDLPGSRQNQKY
MFWFDETFHKPELEKEMDEDTKKQFPAGDNHSGTTSAPGEPETRVIYSSTDGPLGPFVGR
NDSKAGDPMVSSSDESWLDGYPVTDGAWRKTEAEEEEEKDEGNRSVGLEETVLVTPNQPA
LVEVKKPRSTTLTLNEDTTNRSVLPTQTLDVEALALRPMSVSETESPSKGDGDLTRDQST
VPWRYATEKPPMSTLPYELTSSILETVTTAIHKTSNLIPSTVTAATRTPVEITAPEVQDT
FPYLLSEDFLGQEVPGPGASEELLPTLESCVGDKCRSLSR
Download sequence
Identical sequences ENSTTRP00000015914 ENSTTRP00000015914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]