SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015918 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015918
Domain Number 1 Region: 185-376
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-50
Family DBL homology domain (DH-domain) 0.0000126
Further Details:      
 
Domain Number 2 Region: 384-510
Classification Level Classification E-value
Superfamily PH domain-like 6.64e-30
Family Pleckstrin-homology domain (PH domain) 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015918   Gene: ENSTTRG00000016790   Transcript: ENSTTRT00000016790
Sequence length 618
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2497:22395:29120:1 gene:ENSTTRG00000016790 transcript:ENSTTRT00000016790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPERPAPGRTDRILGVMGGMLRACALPGQEGPPKRSPLGLGGTEPESNCTEGNQRGER
EREVPAWAPLPESYSIAGSEGSISASAASGLAAPSGPSSGLSSGPCSPGPPGPVSGLRRW
LDHSKHCLSVETEAEGGQAGPYENWMLEPALATGEELPELTLLTTLLGGPGDKTQPPEEE
TLSQAPESEEDQKKALERSMYVLTELVETEKMYVEDLGQIVEGYMATMAAQGVPENLRGR
DRIVFGNIQQIYEWHRDYFLQELQRCLKDPDWLAQLFIKHERRLHMYVVYCQNKPKSEHV
VSEFGDSYFEELRQQLGHRLQLNDLLIKPVQRIMKYQLLLKDFLKYYSRAGMETEELEQA
VEVMCFVPKRCNDMMTLGRLRGFEGKLTAQGKLLGQDTFWVTEPEAGGLLSSRGRERRVF
LFEQIIIFSEALGGGVRGGTQPGYVYKSSIKVSCLGLEGNLQGDPCRFALTSRGPEGGIQ
RYVLQTADPAVSQAWIKQVAQILESQRDFLNALQSPIEYQRRESQTNSLGRPGGPGVGSP
GRIRPGDRAQVSTHTPINGSLPSLLLFPKGQVARVPLSLDTQASSDIPQAPHDSPPVPPI
PNAPPCQARLAKLDEDEL
Download sequence
Identical sequences ENSTTRP00000015918 ENSTTRP00000015918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]