SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015947 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015947
Domain Number 1 Region: 119-479
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.5e-104
Family Choline/Carnitine O-acyltransferase 0.000064
Further Details:      
 
Domain Number 2 Region: 534-718
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2.56e-55
Family Choline/Carnitine O-acyltransferase 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015947   Gene: ENSTTRG00000016819   Transcript: ENSTTRT00000016819
Sequence length 726
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_231:76680:114632:-1 gene:ENSTTRG00000016819 transcript:ENSTTRT00000016819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NGIITGVYPASPSSWLIVVVGVVSTMYTRIDPSLGIIAKINRTLDRTGYMSSQTKKVVSG
VLFGTGLWVALIFTMRYSLKVLLSYHGWMFAQHGKISRATKVWMGMVKIFSGRKPMLYSF
QTSLPRLPVPAVQDTVNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSWW
ATNYVSDWWEEYIYLRGRGPLMVNSNYYAMDLLYITPTHIQAARAGNGIHAILLYRRKLD
REEIKPIFLLGSTVPLCSAQWERMFNTSRIPGEETDTLQHIRDSRHIVVFHKGRYFKVWL
YHDGRLLKPREIEQQMQRILDDPSEPQAGEAKLAALTAGDRVPWARCRQAYFGHGKNKQS
LDAVEKAAFFVTLDETEQGYREEDPVTSMDSYAKSLLHGRCFDRWFDKSITFVIFKNGKM
GINAEHSWADAPIIGHLWEYVLATDSFQLGYAEDGHCKGDTNSNIPYPTRLQWDIPQEXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMGKFSL
TYEASMTRLFREGRTETVRSCTTESCNFVLAMVDPTQTVEQRLKLFKIASKKHQHLCHLA
MTGSGIDRHLFCLYVVSKYLAVDSPFLKEVLSEPWRLSTSQTPQQQVELFNLERNPEYVS
SGGGFGPVADDGYGVSYILVGEKLISFHISSKFSCPETDSHRFGKNLKQAMIDIMSLFGL
SSNSKK
Download sequence
Identical sequences ENSTTRP00000015947 ENSTTRP00000015947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]