SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016005 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016005
Domain Number 1 Region: 422-640
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.02e-56
Family DBL homology domain (DH-domain) 0.0000564
Further Details:      
 
Domain Number 2 Region: 630-784
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-20
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 3 Region: 785-850
Classification Level Classification E-value
Superfamily SH3-domain 7.09e-16
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016005   Gene: ENSTTRG00000016882   Transcript: ENSTTRT00000016882
Sequence length 870
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_887:255128:401218:1 gene:ENSTTRG00000016882 transcript:ENSTTRT00000016882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGKTEVDFSSNNLTPLWRRRSTPQPQLLGRSKPRPQSYQSPSGLLITDFPVEDRGKPPA
AQTPAQVPTASDGRTIQRSPLLLCAHRRLVTNGRTVSPEYRAVSPRLRRPKSPQEPRAAS
GGYPKSPANGTATSPAQLPLHRPRTPHASAACSPEGDRAGFPASPLLSPAASALIPNTAS
PGARSLSGQMAKDPERGPSRLSPAPHKRSLEQKLPLQRLPSQENELLENPSVVLSTNSPA
ALKVGKQQIIPKSLASEIKISKSNSQNVEPHKRLLKVRSMVEGLGAPLGPAEDEGEAEND
LDSPGSLRRGLRSTSYRRAVVSGVDFDSPTTSKKKNRMSQPILKAVMEDKEKFSSLGRIK
KKMLKGQGTFDGEENAVLYQNYKEKALDIDSDEESEPKEKKSDEKIVVHHKPLRPTWSQL
SAVKRNGLSQTVSQEERKRQEAIFEVISSEHSYLLSLEILIRMFKNSKALSDTMTKTESH
HLFSNITDVCEASKKFFTELEARHQNNIFIDDISDIVEKHTASTFDPYVKYCTNEVYQQR
TLQKLLATNPSFKEVLSRIESHEDCRNLPMISFLILPMQRVTRLPLLMDTICQKTPKDSS
RYEVCKRALKEVSKLVRLCNEGARKMERTEMMYTINSQLEFKIKPFPLVSSSRWLVKRGE
LTAYVEDTVLFSKRTSKQQVYFFLFNDVLIITKKKSEESYNVNDYSLRDQLLVESCDSEE
LNSSPGKNSSTVLYSRQNSASHLFTLTVLSNHVNEKVEMLLGAETQSERARWITALGHSS
GKQPPDRTSLTQVEIIRSFTAKQPDELSLQVADVVLIYQCVSDGWYEGERLRDGERGWFP
MECAKEITCQATIDKNVERMGRLLGLETNV
Download sequence
Identical sequences ENSTTRP00000016005 XP_019789936.1.83887 ENSTTRP00000016005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]