SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016152 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016152
Domain Number 1 Region: 28-453
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.7e-53
Family L-arabinose binding protein-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016152   Gene: ENSTTRG00000017037   Transcript: ENSTTRT00000017038
Sequence length 776
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2240:200857:204290:1 gene:ENSTTRG00000017037 transcript:ENSTTRT00000017038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLALLGLAAVLGVRAGAPLCLSRQLSWPGDYVLGGSAPLGSAEDAFFLLWALATTMAM
EEINSGSTLIPGLRLGYNFFNTCWEPVVAAKPSLVLMAKAGSCSVAAYYDYMQYQPHVLA
VIGPHSFEVVLVTSFFLMPHVSYGASTDWLSSRETFPSFLHTVPSDRVQVAAVVELLREL
HWSWVAAVGSKDEYSWQGLCLFSGLDDAKGTIARESWVPLPRAGSPRLGSVQGLPRRVNQ
SSVRVVRFSACTARTLFSYSIRYRLSPKMWVASEAWLPSNLVMTLPSMDRVGTVLGVPRQ
GAQMPKFPSYVQTCLALAADPAYCASLDAGQPGLEEHVVGPRCPQCDCITLENVTDGLLH
RQTFAFAAVYSVAQALHNTLLCDTSGCPVREPVRPWQHPENTHNLSLRFDTNGNVDVNHD
QKLWVRWDRTPTLRTVGTFNGSLQLWHSQVRWHTQGNQEPVPQCSRQCKEGQVHRVKGFH
SCCYDGTDCKAGSYQRNPALCSKCDQDHRSPDWSRCLPRRPKFLGLLLLAPALGLVLAAL
GLFIWRRHSPVRASGGGPQACSLGLVCLSVLLFPGRPSPASCLAQPPLHHLLLTGCWSTP
FLQAAEIFVGSELQPSWADRLCSRLWLWYPPEVPTGWQVPPTEALVHCHVRSWVSFGLVN
ATLAFLCFLGTFPVKSRPGGYNGARGLTSAMLAYFITWVSFVPADVHTVSQPAVQVGAIL
FCVLGILGTSHPPKCYLLLWRPDLNTPEFFLGGGPGDARGRGSSGGGEETQGENKR
Download sequence
Identical sequences ENSTTRP00000016152 ENSTTRP00000016152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]