SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016197 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016197
Domain Number 1 Region: 558-666
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.7e-21
Family Biotin holoenzyme synthetase 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016197   Gene: ENSTTRG00000017086   Transcript: ENSTTRT00000017086
Sequence length 724
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2171:245619:312253:-1 gene:ENSTTRG00000017086 transcript:ENSTTRT00000017086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEDRLQVANGLIPQKIVSVHLHDSALRLKDQASDTPAQLLEPQPEPSVEGKPELEAMEHV
GREDHQVLGSAPTPGQGGAPGGEPAGESDRGVGSVEHCHLHLSSCHECLELENSTIESVK
FASAEDIPDLPYDYSSGLEGIAHDLCPKREQRRVNLTGKAPNILLYVGSDSQDALDRLQQ
VQSALADCVDTNCYTLYHLPLESALRDPWPDNCLLVVIATRESIPEDLSRRFMAYLSQGG
KVLGLSSPFTLAGFQVTRKAALQDTVQSLVFCKADWSQVRLSVLSSGCVYEGGPGEPLSL
GKLQGHLDNKDEDRLIVQVPFGTRGGEAVLCQHLLLSSSPVVQTQEDFNLLKSSNFRRYE
VLKEILTTLGLSCDAKHVPALTPLYLLSAAEEIRDPLMQWLGKHVDAEGVIKSSKLSLKF
VSSYTSEIEVTPSAIPVVTDIETFSSENFNFEIYQQNLQTKKLGKVILFAEVTTTTMSLL
DGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXDINLRVKWPNDIYYSDLMKLGGVLVNSTLMGETFHILIGCGF
NVTNSNPTICINDLITEYNKQHGAELKPLRADYLIARSVTVLEKLIDTFQDEGPNGVLPL
YYKYWLHSAQQVRLGSAEGPKVWIVGLDDSGFLLVHQENGEVVTVHPDGNSFDMLGNLII
PKQP
Download sequence
Identical sequences ENSTTRP00000016197 ENSTTRP00000016197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]