SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016230 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016230
Domain Number 1 Region: 455-560,682-797
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.63e-52
Family Phosphate binding protein-like 0.0000000431
Further Details:      
 
Domain Number 2 Region: 139-380
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.69e-22
Family L-arabinose binding protein-like 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000016230
Domain Number - Region: 623-655
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0706
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016230   Gene: ENSTTRG00000017122   Transcript: ENSTTRT00000017122
Sequence length 1479
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1914:7939:212691:-1 gene:ENSTTRG00000017122 transcript:ENSTTRT00000017122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPRAECCSPRFWLVLAVLAVSGSRARSQKSPPSIGIAVILVGTSDEVAIKDAHEKDDFX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQ
DFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYI
FEVANSVGLTGYGYTWIVPSLVAGDTDTVPSEFPTGLISVSYDEWDYGLPARVRDGIAII
TTAASDMLSEHSFIPEPKSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHP
KLVIILLNKERKWERVGKWKDKSLQMKYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVE
SVDPLSGTCMRNTVPCQKRIISENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYL
VTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSR
SNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSF
TIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYV
DQVSGLSDKKFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLS
LKGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAIL
QLFGDGEMEELEALWLTGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEHL
FYWQFRHCFMGVCSGKPGMVFSISRGIYSCIHGVAIEERQSVMNSPTATMNNTHSNILRL
LRTAKNMANLSGVNGSPQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFSD
YISEVERTFGNLQLKDSNAYQDPHHRPHSIGSTSSIDGLYDCDNPPFTTQPRSLGKKPLD
IGLPSSKHSQLSDLYGKFSFKSDRYGGHDDLIRSDVSDISTHTVTYGNIEGNAAKRRKQQ
YKDSLKKRPASAKSRREFDEIELAYRRRPPRSPDHKRYFRDKEGLRDFYLDQFRTKETSP
HWEHVDLTDIYKERGEDFKRDSVGGGGPCTNRSHLTHGPADKHGGVGGVPAPWEKNLTSV
DWEERSGGNFCRSCPSKLHNYSSAVPGQNSGRLACIRCACKKAGKLYDISEDSSLQELEQ
PAAPVAVPSSAPAAKYPQSPTNSKAQKKTRNKLRRQHSYDTFVDLQKEEAALAPRSVSLK
DKGRFLDGSPYAHMFEMPAGESAFGNGKAAAPAAGHHHHGNHGGSYMLSKSLYPDRVTQN
PFIPTFGDDQCLLHGSKSYFFRQPTVAGVPKARPDFRALVTNKPVVSALHGAVPGRFQKD
ICIGNQSNPCVPNNKNPRAFNGSSNGHVYEKLSSIESDV
Download sequence
Identical sequences ENSTTRP00000016230 ENSTTRP00000016230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]