SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016318 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016318
Domain Number 1 Region: 434-458
Classification Level Classification E-value
Superfamily Notch domain 0.000068
Family Notch domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000016318
Domain Number - Region: 962-1033
Classification Level Classification E-value
Superfamily EF-hand 0.00405
Family Parvalbumin 0.059
Further Details:      
 
Domain Number - Region: 497-524
Classification Level Classification E-value
Superfamily Notch domain 0.00955
Family Notch domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016318   Gene: ENSTTRG00000017214   Transcript: ENSTTRT00000017215
Sequence length 1244
Comment pep:novel genescaffold:turTru1:GeneScaffold_1961:928472:1014325:-1 gene:ENSTTRG00000017214 transcript:ENSTTRT00000017215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLKLLQRQTYTCLSHRYGLYVCFVGVVVTIVSAFQFGEVVLEWSRDQYHVLFDSYRDNI
AGKSFQNRLCLPMPIDVVYTWVNGTDLELLKELQQVREQMEEEQKAMREILGKNTTEPTK
KSEKQLECLLTHCIKVPMLVLDPALPTNITLKDLPSLYPSFHSASDIFNVAKPKNPSTNV
SVVVFDSTKNVEDAHTGIFKGNSRQTVWRGYLTTDKEVPGLVLMQDLAFLSGFPPTFKET
NQLKTKLPENLSSKIKLLQLYSEASVALLKLNNPKDFQELNKQTKKNMTINGKELTISPA
YLLWDLSAISQSKQDEDVSASRFEDNEELRYSLRSIERHAPWVRNIFIVTNGQIPSWLNL
DNPRVTIVTHQDVFRNLSHLPTFSSPAIESHIHRIEGLSQKFIYLNDDVVWKDVGRMVYL
TWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGDCSGNSGAGRYVGGGGGTGGIGVGQ
PWHFGGGISGVSYCNQGCANSWLADKFCDQACNVLSCGFDAGDCGQDHFHELYKVTLLPN
QTHYVIPKGECLPYFSFAEIAKRGIEGAYSDNPIIRHASIANKWKTIHLLMHSGMNATTI
HFNLTFQSTSDEEFRIQIAVEVDTREEPKRNSTTQKSYQSLVSPSALLPEVEILFEDIPE
EKRFPKVKRHDVNTTGSFQMEVQIPMVNISLLPKETQXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXSYLGGNEVLPGRKLQHYTESYLGFLPWEKKKYFQDLLDXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTSRVPAHMPHMIDRIVMQELQDM
FPEEFDKTSFHKVRHSEDMQFAFSYFYYLMSAVQPLNISQVFDEVDTDQSGVLSDREIRT
LATRIHDLPLSLQDLTGLEHVLINCSKMLPANITQLNNIPPTQEAYYDPNLPPVTKSLVT
NCKPVTDRIHKAYKDKNKYRFEIMGEEEIAFKMIRTNVSHVVGQLDDIRKNPXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVYRDKLKFWT
HCVLATLIIFTVFSFFAEQLIALKRKIFPRRRIHKEASPDRIKV
Download sequence
Identical sequences ENSTTRP00000016318 ENSTTRP00000016318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]