SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016407 from Tursiops truncatus 76_1

(show help)
Strong hits

Sequence:	ENSTTRP00000016407
Domain Number 1	Region: 2-62
Classification Level	Classification	E-value
Superfamily	KRAB domain (Kruppel-associated box)	1.12e-23
Family	KRAB domain (Kruppel-associated box)	0.0013
Further Details:

Domain Number 2	Region: 142-195
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	7.02e-22
Family	Classic zinc finger, C2H2	0.0078
Further Details:

Domain Number 3	Region: 236-288
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	1.16e-20
Family	Classic zinc finger, C2H2	0.005
Further Details:

Domain Number 4	Region: 194-251
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	6.49e-20
Family	Classic zinc finger, C2H2	0.011
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

External link(s)	Protein: ENSTTRP00000016407 Gene: ENSTTRG00000017312 Transcript: ENSTTRT00000017312
Sequence length	288
Comment	pep:known_by_projection genescaffold:turTru1:GeneScaffold_1056:7979:19824:-1 gene:ENSTTRG00000017312 transcript:ENSTTRT00000017312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MAHDLVMFRDVTVDFSQEEWECLNSNQRNLYRDVILENYSNLVSLGGCSVSKPDVITLLE QGKEPWMVVRDEKRRRSLDLESRYGTKKLFEVKDVCEMNVFQWEIMERIRSCGLEEQEGP QEAYFRQVKKTTSEKMPKNKKRTSLTLYQRIHTREKPYECGDCGKAFRVRQQLTFHQRIH TGEKPYECKECGKAFRQCAHLSRHQRIHASDKLLECKRCGKIFTCGADLRVHQRIHVGEK PYDCKECGKAFRVRGQLNLHQRIHTGEKPYECKECGKTFRQYAHLTRH
Download sequence
Identical sequences	ENSTTRP00000016407 ENSTTRP00000016407

SEARCH