SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016434 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016434
Domain Number 1 Region: 249-391
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.93e-34
Family cAMP-binding domain 0.00000204
Further Details:      
 
Domain Number 2 Region: 177-245
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000000301
Family cAMP-binding domain 0.0000559
Further Details:      
 
Domain Number 3 Region: 2-44
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000000392
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016434   Gene: ENSTTRG00000017342   Transcript: ENSTTRT00000017342
Sequence length 399
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2343:424505:487198:-1 gene:ENSTTRG00000017342 transcript:ENSTTRT00000017342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVDYFTRLREARSRASTPPAASFRLPGL
EPGPGLVADAIADSESDEEDLDXXXXXXXXXXXXXCAETYNPDEEEEDTDPRVIHPKTDQ
QRCRLQEACKDILLFKNLDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTYD
ILVTKDNQTRCVGQYDNHGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNN
AKKRKMFESFIESVQLLKSLEVSERMKIVDVIGEKVYKDGERIITQGEKADSFYIIESGE
VSILIKSKTKANKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQ
AFERLLGPCMDIMKRNISHYKEQLVKMFGSSMDLIDPGQ
Download sequence
Identical sequences ENSTTRP00000016434 ENSTTRP00000016434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]