SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016441 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016441
Domain Number 1 Region: 165-513
Classification Level Classification E-value
Superfamily Inosine monophosphate dehydrogenase (IMPDH) 9.29e-116
Family Inosine monophosphate dehydrogenase (IMPDH) 0.0000000000761
Further Details:      
 
Domain Number 2 Region: 18-130
Classification Level Classification E-value
Superfamily Inosine monophosphate dehydrogenase (IMPDH) 5.13e-29
Family Inosine monophosphate dehydrogenase (IMPDH) 0.00000201
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000016441
Domain Number - Region: 115-164
Classification Level Classification E-value
Superfamily CBS-domain pair 0.000636
Family CBS-domain pair 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016441   Gene: ENSTTRG00000017349   Transcript: ENSTTRT00000017349
Sequence length 514
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2343:617407:622189:-1 gene:ENSTTRG00000017349 transcript:ENSTTRT00000017349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVV
LSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDRFLGEIMT
KREDLVVAPAGITLKEANEILQLSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDA
KKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKEKYPSLQVI
GGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVP
VIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM
DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVR
AMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
Download sequence
Identical sequences ENSTTRP00000016441 ENSTTRP00000016441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]