SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016477 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016477
Domain Number 1 Region: 361-581
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-53
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 721-783
Classification Level Classification E-value
Superfamily SH3-domain 5.78e-16
Family SH3-domain 0.0017
Further Details:      
 
Domain Number 3 Region: 581-704
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000184
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016477   Gene: ENSTTRG00000017386   Transcript: ENSTTRT00000017386
Sequence length 805
Comment pep:known_by_projection scaffold:turTru1:scaffold_113886:99651:109062:1 gene:ENSTTRG00000017386 transcript:ENSTTRT00000017386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCGPPPALQSHLAGPPGTAHRPVAVCQQESLSFAELPTLQPPSPVCLDLFPVAPEELQA
PGSRWSLGTPAPLQGLLWPPSPGGPDTEISTGGGMRPSRAGSWPHCPSAQSPALEGPWSS
QHLQPQRRASHGSEKKSAWRKMRVYQQEEALGSPEAHAVFLEPSQATEQALSTAEPRPLE
LPGPTRVGLEGPERRRFSASELMTRLHSSLRLGRNSAARALTPGSGPGAAAREGKASGRE
SRSVEMRVDAMAMPALVDLSGGHGSWPEPRLDAQEEPAPGSRSASERRQSRFLLNSVLYQ
EYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLSPSSSFRAQRSARGSTFSLWQ
DIPDVRGSGVLATLSLRDCKLQEAKFELITSEASYIHSLSVAVGHFLGSTELSECLGVQD
KQWLFSKLPEVKSTSERFLQDLEQRLEADVLRFSVCDIVLHHCPAFRRVYLPYVTNQAYQ
ERTYQRLLLENPKFPSILARLEESPVCQRLPLTSFLILPFQRITRLKMLVENILKRTAQG
SEDEDMATKAFNALKELVQECNASVQSMKRTEELIHLSKKIHFEGKIFPLISQARWLVRH
GELVELAPLPAAPPSKLKLSSKAVYLHLFNDCLLLSRRKELGKFAVFVHARMAELQVKDL
SLKLQGIPGHVFLLQLLHGQHTKHQFLLRARTESEKQRWISAMCPSTPQEDREVISEGED
RPQVQCVRTYKALQPDELTLEKTDILAVRTRTSDGWLEGVRLADGEKGWVPQAYVEEISS
LSARLRNLRENKRITTAASKLGEPV
Download sequence
Identical sequences ENSTTRP00000016477 ENSTTRP00000016477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]