SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016479 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016479
Domain Number 1 Region: 506-567
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000163
Family SH3-domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016479   Gene: ENSTTRG00000017388   Transcript: ENSTTRT00000017388
Sequence length 573
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_98:73226:225131:1 gene:ENSTTRG00000017388 transcript:ENSTTRT00000017388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSKILAKLERLKQQNEDL
RRMAESLRIPEGPIDQGPASGRVRALEEQLVKAKEQIENYKKQTRNGLGKDHEVLRRRIE
NGAKELWFFLQSELKKLKNLEGNELQRHADEFLSDLGHHEXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQRT
LILESHNWRYATGGWETVFRPVSETCTDRSGISTGHWSGEVKDKNVQVELPIVDSLHPRP
PYLPLAVPEDFADRLVRVHGDAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVIGV
HVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTXXX
XXXXXXXXXXXXXXXLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQTL
HPDASANFHSLDDIYYFGGQNAHNQIAIYPHQPRTADEIPMEPGDIIGVAGNHWDGYSKG
VNRKLGRTGLYPSYKVREKIETVKYPTYPEAEK
Download sequence
Identical sequences ENSTTRP00000016479 ENSTTRP00000016479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]