SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016522 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000016522
Domain Number 1 Region: 50-188
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.22e-36
Family Regulator of G-protein signaling, RGS 0.00012
Further Details:      
 
Domain Number 2 Region: 357-458
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.68e-33
Family Ras-binding domain, RBD 0.0000586
Further Details:      
 
Domain Number 3 Region: 302-370
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-20
Family Ras-binding domain, RBD 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016522   Gene: ENSTTRG00000009574   Transcript: ENSTTRT00000021447
Sequence length 499
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2447:174133:187659:1 gene:ENSTTRG00000009574 transcript:ENSTTRT00000021447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGKPKHLGVPNGRMVVAVSDGELSSTAGPQGQGEGRGSSLSIHSLPSGPSSPFPTEEQP
VASWGLSFERLLQDPLGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTQQLAQEARN
IYQEFLSSQALSPVNIDRQAWLGEEVLAEPRPDMFRAQQLQIFNLMKFDSYARFGLSPLY
RECLLAEAEGRPLREPGSSRLGSPDATRKKPKLKPGKSLPLGVEELGQLPPAEGPGGRPL
RLSFRRLGGGASNSALRRESQGSLNSSASLDLGFLAFVSSKSESHRKSLGSSEGESESRP
GKYCCVYLPDGTASLALARPGLTIRDMLEGICEKRGLSLPDIKVYLVGNEQALVLDQDCT
VLADQEVRLENRITFELELAPLERVVRISAKPTKRLQEALQPILAKHGLSPQQVSLRRPG
EKQPLDLRKLVSSVAAERLVLDALPGVKITEAGDISPCLSQGGPPTIQDKAAHLPPLSLN
SLAQAPSSITGKRQTCDIE
Download sequence
Identical sequences ENSTTRP00000009074 ENSTTRP00000016522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]