SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000016609 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000016609
Domain Number - Region: 60-166
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.00333
Family Brix domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000016609   Gene: ENSTTRG00000004530   Transcript: ENSTTRT00000021469
Sequence length 467
Comment pep:novel genescaffold:turTru1:GeneScaffold_1241:39267:43281:1 gene:ENSTTRG00000004530 transcript:ENSTTRT00000021469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQSGRSRHQKRARAQAHLRNLEAYAAQPHSFVFSRGRAGRSVRQLSLDLRRVMEPLTAT
RLQIRKKNSLKDCVAVAGPLGVTHFLILSKTETSVYFKLIRLPGGPTLTFRINKYTLVRD
VVSSLRRHRMHEQQFAHPPLLVLNSFGPHGMHVKLMATMFQNLFPSINVHKXXXXXXXXX
XXXXXXXXXXXXXXXXXSIRVVPVGASRGMKKLLQEKFPNMSRLQDVSELLATGAGLSES
EAEPDGEHNITVLPQAVAGRGNMPAQQSAVRLTEIGPRMTLQLIKIQEGVGEGNVLFHSF
VHRTEEELQATLAAKEEKLRLKAQRQDQQAQNVQRKREQREAHRKKSLAGMKRAQAEADG
DSDAEDPGAPAEAEGVSQQEEEDEAEYFRQAVGEEPDEDMFPKAAKWRRPAGPPGKKRRV
KERKPDRGSDRRPPKAKGRHPGAQAKLGPRGAARDHRRGDRGHKRVA
Download sequence
Identical sequences ENSTTRP00000016609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]