SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000273 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000273
Domain Number 1 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.73e-25
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 317-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.8e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 374-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 415-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.62e-21
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 5 Region: 11-66
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.11e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 130-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000239
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000273   Gene: ENSTTRG00000000291   Transcript: ENSTTRT00000000291
Sequence length 476
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3312:10542:14880:-1 gene:ENSTTRG00000000291 transcript:ENSTTRT00000000291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPLISVVIMGFIQGKVNFEDVFVYFSQEEWGLLDEAQRLLYREVMLENFALMASLGYASS
MFHGIAPLELDSEPWLSEWANMTPAMTREAQGGGGPGCSHGMEEEEIPFEQSVSVKGVSQ
VTIPKTIPSSQKAHPCETCGPILKDVLYLAEHQETHPEQKPYMCVACGKQLCFSANLHHQ
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFTTGEGCKDFPTSSSISHHAPSKWKPQSNT
KCAEAFHSGQMHYKCNECGKAFSRKDSLVQHQRVHTGERPYECSECGKTFSRKPILAQHQ
RIHTGEMPYECGICGKVFNHSSNLIVHQRVHTGARPYKCSECGKAYSHKSTLVQHESIHT
GERPYECSECGKYFGHKYRLIKHWSVHTGTRPYECIACGKFFSQSSDLIAHQRVHNGEKP
YVCSECGKAFSHKHVLVQHHRIHTGERPYKCSECGKAFRQRASLIRHWKVHAGERP
Download sequence
Identical sequences ENSTTRP00000000273 ENSTTRP00000000273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]