SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000726 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000726
Domain Number 1 Region: 37-98
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.24e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 740-797
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.83e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 573-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-23
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 4 Region: 628-685
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.2e-23
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 5 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.51e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 460-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 404-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.96e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 9 Region: 684-741
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.57e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 10 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 11 Region: 516-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.24e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 12 Region: 186-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000726   Gene: ENSTTRG00000000771   Transcript: ENSTTRT00000000771
Sequence length 819
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_57:31697:40967:1 gene:ENSTTRG00000000771 transcript:ENSTTRT00000000771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQVALSHSLFIISWLLWTLCFSTEEAQRGTSSCSSTTMAHMSLSFRDVAIDLSQEEWECL
DAVQRALYRDVMLENYSNLVSLGCSSPKPDVITLLEQEKEPWTVMREGTRSWYTDLESKY
VTKKLFPEKDICEIYLFQLQRVDKSKTYIREDTIFRNDLQCKHEFERQEGHQMRCASQMI
IQKHIPLLLHQKIHAREKSYECKECKKAFRQQSYLIQHLRIHTGERPYKCKECGKAFCRV
GDLRVHQTIHGGERPYECNNCGKTFRLHYHLTEHQRIHSGVKPYECNECGKAFSRVRDLR
VHQTIHAGERPYECKDCGKAFRLHYQLTEHQRIHTGERPYECKICGKTFRVQRHISQHQK
IHTGVKPYKCNDCGKAFSHGSYLVQHQKIHTGDKPYVCKECGKSFSFHAELTRHHRIHTG
EKPYECKECRKAFRLQTELTRHCRIHTGEKPYECKECGKAFICGYQLTLHLRVHTGEIPY
ECKECGKTFSSRYHLTQHYRIHTGEKPYGCKECGKAFRLQAELTKHHRIHTCEKPYECKE
CGKAFIRSNQLISHQRIHTNENTYECKECGKIFSRRYNLTQHYKIHTGEKPYVCKECGKA
FRFQTELTQHHRIHTGEKPYKCKECGKAFIRSNHLTQHHRIHTGEKPYKCKECGKTFSRH
YHLTQHHRIHTGEKPYICNECGDAFICSYQLTLHQRIHTGEIPYECKECGKTFSRRYHLT
QHFRLHTGEKPYGCKECGDAFRLQAELTRHHTIHTGEKPYKCKECGKAFSVKSELTRHHR
IHTGEKPYKCKECGKAFIRSDQLTLHQRNHISEEPPFIM
Download sequence
Identical sequences ENSTTRP00000000726 ENSTTRP00000000726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]