SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000894 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000894
Domain Number 1 Region: 175-301
Classification Level Classification E-value
Superfamily PH domain-like 4.79e-33
Family Pleckstrin-homology domain (PH domain) 0.00046
Further Details:      
 
Domain Number 2 Region: 338-442
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-24
Family SH2 domain 0.0000339
Further Details:      
 
Domain Number 3 Region: 24-80
Classification Level Classification E-value
Superfamily Phenylalanine zipper 0.000000000012
Family Adapter protein APS, dimerisation domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000894   Gene: ENSTTRG00000000951   Transcript: ENSTTRT00000000950
Sequence length 558
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_792:164028:190307:1 gene:ENSTTRG00000000951 transcript:ENSTTRT00000000950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGPTLQSSSASSASSAATAPSPRGWSEFCELHAVAARELARQYWFAREHPHAPLRAELV
SLQTDLFQRYFCREVREGRAPGRDYRETGRGTPAKAEVSPAEPGPAAPAPAPGLPKARSS
EELAPPRPACSLQHLRHSLRHIFRHRSAGELPAAPSAAAGEAGEAPARPGLARKLLPWSL
AREPPPEALKEATLRYSLADEASMDSGARWQRGRLALRRAGPDGADRLLELFDPPKSSKP
KLQAACSSIQEIRRCTRLEMPDNLYTFVLKVKDRTDIIFEVGDEQQLNSWMAELRECAGQ
GLSTDPEMHIPSALEPGTSNSPRGSTDSLNQGASPGGLLDPACQKTDHFLSCYPWFHGPI
SRVKAAQLVQLQGPDAHGVFLVRQSETRRGEYVLTFNFQGIAKHLRLSLTERGQCRVQHL
HFPSVVDMLHHFQRSPIPLECGAACDVRLSSYVVVVSQPPGSCNTVLFPFSLSRWDSELG
LPHLSASGCPRGLGPEGLPGRSSPPEQIFHLVPSPEELANSLRHLEPEPTSRARDSDYEM
DSSSRSHLRAIDNQYTPL
Download sequence
Identical sequences ENSTTRP00000000894 ENSTTRP00000000894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]