SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001120 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001120
Domain Number 1 Region: 40-337
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.63e-26
Family FAD-linked reductases, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001120   Gene: ENSTTRG00000001196   Transcript: ENSTTRT00000001194
Sequence length 509
Comment pep:known_by_projection scaffold:turTru1:scaffold_96618:53601:74110:1 gene:ENSTTRG00000001196 transcript:ENSTTRT00000001194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERTRGRLACSPWGLWAGGCLLLCSWGFPGGAEPRAPPENIAIIGAGIGGTSAAYYLRQK
FGNDVKIDVFEKGEVGGRLATVTMQGQEYESGGSVIHPLNLHMKRFVKDLGLSAVQSPSG
LVGVYNGETLVYEESSWFIINMIKLIWHYGFQSLRMHMWVEDILDKFMRIYRYQSHDYAF
SSVEKLLHSLGGDDYLGLFNRSLLETLQKAGFSEKFLDEIITPVMRVNYGQTMNINGFVG
AVSMSCTDPGLWAVKGGNKLVCSRLLQASKSNLISGSVMSIEEKTRTKQTGNPTKVYEAV
YQTGSETHSAFYDIVLVATPLNRKMSNITFLNFDPPIEEFHQYYEPLVTTLIKGQLNSTV
FTSRALDEFDLGTVLTTDNPDLFINSIGFVSSVEESNNPQPKADRSHVWKIFSAGPLTKE
QILKLFVSYDYAVKRSWLAYPHYTPPEKCPSIILHDRLYYLNGMEVAASAMEVSAVAGYN
AALLAYHRWNGHTHMIDQEDLYEKLKTEL
Download sequence
Identical sequences ENSTTRP00000001120 ENSTTRP00000001120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]