SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001867 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001867
Domain Number 1 Region: 498-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.57e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 611-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 442-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 4 Region: 554-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 386-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 330-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 33-92
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 8 Region: 656-708
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.89e-17
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 9 Region: 280-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-16
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 10 Region: 223-268
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000335
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 11 Region: 128-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000291
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001867   Gene: ENSTTRG00000001992   Transcript: ENSTTRT00000001991
Sequence length 709
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1069:70890:78690:-1 gene:ENSTTRG00000001992 transcript:ENSTTRT00000001991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSPPSPQVVTGPEASQMDPAHPTYWPPGLAVSSLQSLVTFEDVAVHFSKEEWGLLDAAQR
QLYHSVMLENLELMTSLGCWHGVEDEEVCSKQDASVDVVSQVRIFSAHFSTQKADSCDMC
DPFLKDILHLDVHQGTHAEETPYTCVACGREFWFGANLHQHQKECSGEKPFKWDKDRDLF
VQSSIVCLSEKPFTCGLGGKDVSDSHDLLQHPNTDGSGKRPYSSLGQLPEVHASQKPFKC
SDCGKAFQKSSVLLNHLRTHSEEIPFRCLRVENSLEEKLTLVNDQKFHTGETSHICKECG
KAFSHPSKLRKHQKFHTGVKYYECSDCGKTFSYKLTLVHHQRIHTGERPYECSECGKAFN
NRSHLTRHEKVHTGERPFECSKCGRAFSQSSNFLRHQKVHTQVRPYECNQCSKAFSRSSA
LIQHWRVHTGERPYECSECGRAFNNNSNLAQHQKVHTGERPFECTECGRDFNQSSHLLRH
QKVHTGERPFGCSECGKAFSNSSTLIQHQKVHTGQRPYECSECRKAFSRNSSLIQHWRIH
TGERPYECNECGKAFAHSSSLIEHWRVHTRERPYECSECGKFFSQNSILIKHQKVHTGER
PYECTECGKFFSRKSSLIYHWRVHTGERPYECSECGRAFSNNSHLVRHQRVHTQERPYEC
SQCGKAFSERSTLVRHQIVHTRERTYECGHCGKIFSRLCNLAQHKRIHT
Download sequence
Identical sequences ENSTTRP00000001867 ENSTTRP00000001867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]