SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001870 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001870
Domain Number 1 Region: 21-109
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.16e-37
Family SCAN domain 0.0000139
Further Details:      
 
Domain Number 2 Region: 340-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000279
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 213-253
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000654
Family KRAB domain (Kruppel-associated box) 0.0031
Further Details:      
 
Domain Number 4 Region: 294-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000892
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001870   Gene: ENSTTRG00000001994   Transcript: ENSTTRT00000001994
Sequence length 397
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1069:111010:114039:1 gene:ENSTTRG00000001994 transcript:ENSTTRT00000001994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSPLGPPSLPSVDPEATLEDPEAARQRFRGFCYQEVAGPREALAQLRDLCRQWLRPEVH
SKEQMLELLVLEQFLGALPSEIQAWVRGQQPGSPEEATVLVEGLQHDPGQLLGWITAHVL
KQAVLPATQNTEESVGSSHPSGTVEPRKAASWEGSKDAQLEENAQLSCSVKEEPDGYGQE
TAPSSPPHPARSHEGPAEQQEPTSVPFQPPRIQEEWGLLDRSQKEVYWDAMLQKYGTVVS
LGLPCPLPEARTEPEPEALSTGSEGARSLLPGGESESSREGRPGCPEAPPPARSKPYTCA
QCGRTFDWKSVFVIHRRAHAGGPGAEKQGGAPRRALPGPRSYACEECGRSFSWKSQLVIH
RKGHAGQRRHFCGDCGHSFDWKSQLVIHRKSHRPEAP
Download sequence
Identical sequences ENSTTRP00000001870 ENSTTRP00000001870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]