SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002500 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002500
Domain Number 1 Region: 573-729
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.65e-36
Family MAM domain 0.00073
Further Details:      
 
Domain Number 2 Region: 891-1054
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-30
Family MAM domain 0.0028
Further Details:      
 
Domain Number 3 Region: 732-888
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-27
Family MAM domain 0.0013
Further Details:      
 
Domain Number 4 Region: 270-423
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-16
Family MAM domain 0.018
Further Details:      
 
Domain Number 5 Region: 224-263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000929
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 6 Region: 487-571
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000237
Family MAM domain 0.01
Further Details:      
 
Domain Number 7 Region: 453-492
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000157
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 8 Region: 158-220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000253
Family MAM domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002500   Gene: ENSTTRG00000002663   Transcript: ENSTTRT00000002665
Sequence length 1137
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3601:45041:53865:1 gene:ENSTTRG00000002663 transcript:ENSTTRT00000002665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLPGHLLPVLVLLLARSPGWAWGPSRCRPPREAVCNFVCDCRGCPDEAQCXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVAELRLELTHGVETLTLWRSSGPWVPGW
QELVVPTGRIQGDFRVTFSATRNATRRGAVALDDVAFWSCGLPTPQAHCPLGHHHCQNKA
CVEPHQLCDGEDNCGDGSDEDTPTCNHHTATDFERGLGLWNRSEGWARNHSAGGPQHPAW
PHRDHSRNSAQGSFLVAVAEPSAPAILSSPEFQASAPEKCSLTFYHYLHGSQAGCLQVFL
QTRSAGAPHAAVLLRRRHRELGAAWVRDRVDIQSKHPFRILLAGQTGPGGVVGLDDLILS
DHCKPVPEVAGPPPGLWAPGPRSQLSSLQPWNFCEPGHLLCGELCVPPEQLCDFQQQCPG
GEDEQECGTTDFESPSAGGWEDASVGRLQWVRLPAQDSGSPGMDASGAAGHFLSVQRAWG
QLAEQARVLTPTLGPSGPRCELHMAYYFQSHPQEISCNFERDTCGWHTGHLTDAHWHRVE
SRGPGYDHTTGQGHFMLLDPTEPPAQGPGAHLLTWPQSPAAAQECLSFWYHLYGPQIGTL
RLAMRREGERERHLWSRSGTHGNRWHEAWATLHHPQDSSAKYQLLFEGLRDGYHGTMALD
DMTVRPGPCWAPKRCSFEDSACGFSTGGRGLWTRQTNATGQAARGPPADHTTETAQGHYM
VVDMSPQQPRGHVASLISEEHRPLAQAACLTFWYHLSLRNPGTLRVHVEEAERRQVLSIG
TDGGFAWRLGSVDLQAERAWRVVFEAVAAGVERSYIALDDLLLQDGPCPRPASCDFEAGL
CGWNHLPWPGLGGYSWDWSSGAAPSRYPQPPVDHTLGTEAGHFALFETGVLGPGGRAAWL
RSQPLPATEASCLRFWYHMGFPEHFYKGELRVLLSSARGQLAVWGAGGRLRHQWLEGQVE
VASAEEFQIVFEATLGGQPALGPIALDDVEYLAGQRCQLPTPSQGDTAVATSVPAVVGGT
LLLLMLLVLLGLAGRRWLQNRGGCPFWGETDTVAPSFDNILFNAGHVTLPASVTNDQ
Download sequence
Identical sequences ENSTTRP00000002500 ENSTTRP00000002500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]