SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002571 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002571
Domain Number 1 Region: 182-304
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 3.14e-60
Family Dystroglycan, domain 2 0.000000318
Further Details:      
 
Domain Number 2 Region: 497-597
Classification Level Classification E-value
Superfamily Cadherin-like 8e-19
Family Dystroglycan, N-terminal domain 0.014
Further Details:      
 
Domain Number 3 Region: 62-160
Classification Level Classification E-value
Superfamily Cadherin-like 6.43e-17
Family Dystroglycan, N-terminal domain 0.0000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002571   Gene: ENSTTRG00000002743   Transcript: ENSTTRT00000002743
Sequence length 892
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2780:61874:78405:1 gene:ENSTTRG00000002743 transcript:ENSTTRT00000002743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSVALSLLLPLWGRTFLLLLSVAVTQSRWPSEPSEAVRDWENQLEASMHSVLSDLHEA
VPTVVGIPDGTAVVGRSFRVTIPTDLIASNGEVIKVSAAGKETLPSWLQWDPQSHTLEGL
PLDTDKGVHYISVSTARLGANGSHVPQTSSVFSVEVYPEDHSEPQSVRAASPDPGEVVSS
VCAADEPVTVLTVILDADLTKMTPKQRIDLLHRMRSFSEVELHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIRGVEVPAREGAMSAQLGYPVVGWHIA
NKKPPLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMTPPVRD
PVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPP
TITTKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPVPRVTTKAPVTRLETASPPTRI
RTTTSGMPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDNEDTTTDKLKLTLKL
REQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQ
GDRAPARFEAKFVGDPAAVVNDIHKMIAVKKLAFAFGRNCXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XTLEGQATVIKKGVPIIADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQNVPETTPLN
QDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences ENSTTRP00000002571 ENSTTRP00000002571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]