SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002581 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002581
Domain Number 1 Region: 32-240
Classification Level Classification E-value
Superfamily L domain-like 3.47e-35
Family Ngr ectodomain-like 0.0023
Further Details:      
 
Domain Number 2 Region: 285-381
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000384
Family I set domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002581   Gene: ENSTTRG00000002754   Transcript: ENSTTRT00000002753
Sequence length 509
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2780:223041:224570:-1 gene:ENSTTRG00000002754 transcript:ENSTTRT00000002753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLVLQGTLLCMLRVGLMSTLDSEGFLSPAPHNCPYKCVCAADLLSCAGLGLQDVPGAL
PAAAADLDLSHNALQRLRPGWLAPLSRLRALRLNHNELDTLGPGVFTNASGLRLLDLSSN
ALRALGRHDLDGLGELKMLLLFNNRLAHLDEQAFHGLGALSRLYLGCNELASFSFNHLHG
LGTTHLRTLDLSSNHLGRIPVPDLASLPAFLKNGLYLHNNPLPCDCRLYHLLQRWHQRGL
SAVSDFAGEYTCLAFKVPTSRVRFFEHSRVFENCSAALARGLEQPEEQLHVQVGQSLRLH
CNTSAPAVHIAWVSPQHELLVAPGSRNGSIAVRADGSLAISNVQPWHEGVFVCLATGPHL
HHNQTHEYNVSVHFPHPEPDTFNTGFTTLLGCAVGLVLVLLYLFTPPCPGCRSCYHHTCR
CRRWPRTPSPLQELSAQSSVLSTTPPDAPRRKASVHKHVVFLEPGRRSLNGRVQLAVAED
FDLHNPLGLRLKAGSESTSSTGSEGLVMT
Download sequence
Identical sequences ENSTTRP00000002581 XP_012393739.1.21590 XP_019787241.1.83887 ENSTTRP00000002581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]