SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002877 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002877
Domain Number 1 Region: 25-213
Classification Level Classification E-value
Superfamily Cupredoxins 2.77e-57
Family Multidomain cupredoxins 0.00000178
Further Details:      
 
Domain Number 2 Region: 377-575
Classification Level Classification E-value
Superfamily Cupredoxins 3.1e-52
Family Multidomain cupredoxins 0.00000515
Further Details:      
 
Domain Number 3 Region: 733-917
Classification Level Classification E-value
Superfamily Cupredoxins 1.28e-47
Family Multidomain cupredoxins 0.00000519
Further Details:      
 
Domain Number 4 Region: 924-1070
Classification Level Classification E-value
Superfamily Cupredoxins 5.16e-45
Family Multidomain cupredoxins 0.00000494
Further Details:      
 
Domain Number 5 Region: 578-722
Classification Level Classification E-value
Superfamily Cupredoxins 1.32e-44
Family Multidomain cupredoxins 0.00001
Further Details:      
 
Domain Number 6 Region: 223-366
Classification Level Classification E-value
Superfamily Cupredoxins 1.08e-37
Family Multidomain cupredoxins 0.0000447
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002877   Gene: ENSTTRG00000003062   Transcript: ENSTTRT00000003064
Sequence length 1163
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3002:40676:130307:1 gene:ENSTTRG00000003062 transcript:ENSTTRT00000003064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRKRPAGCILLLTFLGLSGMVGAVTRTYHIGIVEEYWNYVPQGKNVITGKSFAEDKLAT
LFLKRGPNRIGGIYKKAVYRHYTDETYSTEIPKPPWLGFLGPILRAEVGDVIVIHLKNFA
SRPYSLHPHGVFYNKDSEEGALYPDGTYGRNKDDDNVPPGKNYTYVWPVREEYAPAPADA
NCLTWVYHSHIDAPKDICSGLIGPLLVCKEGILHKYSGTRTDVNQEFVIMFTVVDENQSW
YLEENIRFCTXXXXXXXXXXXXXXXXXXXXLNGYLFGNFPEPDMCVGESVSWHLFGMGNE
IDIHSIYFYGNTFISRGHRTDVVNLFPATFLTTEMIVENPGKWMITCQVSDHFQAGMLGQ
YNVGNCKSGIFHPKMKGQQRRYFIAAEKILWDYGPQGYNKFSGLPLNASGSDSELYFTQG
DNRIGGKYWKAQYIEYVDATFTRRKRLSEAEAHLGILGPIIKAEVGDTLLVTFANKADKV
YSILPHGVIYDKASDAAPNVDGKSRFLKPGAHVKPGETFTYRWTMPESISPTADDPPCLT
YLYFSAVEPINDTSSGLVGPLLVCKKGILNADGTQKGIDKEFYLLFTVFDENLSRYLDEN
IQKFTWRPFSVDKEDKEFVKSNRMHAINGYMYGNQPGLTMCKKDRVSWHMIGMGTDTDMH
GVYFQGNTIHLRGTHRDSLALFPHVSTTAFMQPDHAGIFRVFCSTLYHFQRGMNQIYEVS
SCGNKDPSEQPYGMIRTFYIAAEEVEWDYAPNKNWEFEKQHSDGGWERHGDIFMNHTENW
IGSQYKKVVYREYTNGEFVEIKAQPPQEEHLALLGPMIHAEVGDSILIIFMNKASRPYSI
SAHGVEDMESGKGLPVPVTKPGEIKTYRWNVPKRSGPGPSDPNCIPWVYYSTVNFVKDTY
SGLMGPLITCREGVLNEKGRRSDVDSEFVLLFLVFNENESWYLDDNIKKYLNKDPQDFKP
SDDFEESNKMHAINGKIFGNLHGLIMNENTMTNWYLLGIGSEVDIHTIHYHAESFLFKID
KSYREDVYDLFPGTFQTIELFVDHPGTWLLHCHVSDHIHAGMETTYTVLRNIDNRIPYST
KPPSGGASHPATAPSNEEPGKEQLYFFGKNLGPRGAKAALVILFIIGLLLLVVTVILSLT
LCSARKRVAYQEVQSCALPTDAL
Download sequence
Identical sequences ENSTTRP00000002877 ENSTTRP00000002877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]